Parametereinstellungen
Synonymic Value: 1.1700
Non-Synonymic Value: 3.0000
Blast-Hit-End Value: -9.1000
Query Stop-Codon Value: -3.0000
Hit Stop-Codon Value: -3.9800
Frameshift-Span: 217.0000
Prediction-Span: 368.0000
Leavegene-Value: -1.3000
cURL-DB: nucleotide
Output-Filename: Metagenome_454
Output-Fileformat
(1/2/3):
2
Hitfile
(yes=1/no=0):
1
Min-Protein-Length
(>=15):
15
Min-Result-Percentage: 0.0500
Extended-Modus
(yes=1/no=0):
1
Homology-Modus
(yes=1/no=0):
0
Codon-Modus
(1/2/3):
3


Query-DNA-Entry-Section

Query-DNA-Def read_001|beg|888|length|144|forward|gi
Query_DNA-Sequence
caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc

Coding-DNA-Entry-Section

Coding-DNA
tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtggg
Protein-Sequence
GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWV
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613
gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340


Query-DNA-Entry-Section

Query-DNA-Def read_002|beg|758|length|128|forward|gi
Query_DNA-Sequence
ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt

Coding-DNA-Entry-Section

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912


Query-DNA-Entry-Section

Query-DNA-Def read_003|beg|1382|length|0|reverse|gi
Query_DNA-Sequence
ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_005|beg|1748|length|0|reverse|gi
Query_DNA-Sequence
gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag

Coding-DNA-Entry-Section

Coding-DNA
taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt
Protein-Sequence
KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF
Hit-Information Section
gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436


Query-DNA-Entry-Section

Query-DNA-Def read_007|beg|433|length|0|reverse|gi
Query_DNA-Sequence
ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_009|beg|558|length|0|reverse|gi
Query_DNA-Sequence
ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_011|beg|1241|length|142|forward|gi
Query_DNA-Sequence
agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_012|beg|1105|length|116|forward|gi
Query_DNA-Sequence
agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg

Coding-DNA-Entry-Section

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170


Query-DNA-Entry-Section

Query-DNA-Def read_013|beg|1597|length|0|reverse|gi
Query_DNA-Sequence
cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt

Coding-DNA-Entry-Section

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271


Query-DNA-Entry-Section

Query-DNA-Def read_015|beg|106|length|0|reverse|gi
Query_DNA-Sequence
ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_018|beg|969|length|0|reverse|gi
Query_DNA-Sequence
ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg

Coding-DNA-Entry-Section

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144


Query-DNA-Entry-Section

Query-DNA-Def read_020|beg|737|length|114|forward|gi
Query_DNA-Sequence
ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc

Coding-DNA-Entry-Section

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398


Query-DNA-Entry-Section

Query-DNA-Def read_021|beg|24|length|0|reverse|gi
Query_DNA-Sequence
tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg

Coding-DNA-Entry-Section

Coding-DNA
ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg
Protein-Sequence
FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686
gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051


Query-DNA-Entry-Section

Query-DNA-Def read_024|beg|1651|length|104|forward|gi
Query_DNA-Sequence
tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_025|beg|364|length|0|reverse|gi
Query_DNA-Sequence
tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_027|beg|980|length|135|forward|gi
Query_DNA-Sequence
accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_028|beg|91|length|0|reverse|gi
Query_DNA-Sequence
aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct

Coding-DNA-Entry-Section

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230


Query-DNA-Entry-Section

Query-DNA-Def read_030|beg|369|length|133|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302


Query-DNA-Entry-Section

Query-DNA-Def read_031|beg|1449|length|127|forward|gi
Query_DNA-Sequence
gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat

Coding-DNA-Entry-Section

Coding-DNA
ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg
Protein-Sequence
LELVKKANLIIYSERLKRK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610


Query-DNA-Entry-Section

Query-DNA-Def read_032|beg|1594|length|105|forward|gi
Query_DNA-Sequence
caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_034|beg|1680|length|114|forward|gi
Query_DNA-Sequence
tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga

Coding-DNA-Entry-Section

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426


Query-DNA-Entry-Section

Query-DNA-Def read_035|beg|403|length|141|forward|gi
Query_DNA-Sequence
catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga

Coding-DNA-Entry-Section

Coding-DNA
ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga
Protein-Sequence
SSRSLNVSILVFPVTRPLSR
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 6 from: 172424 to: 172495
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253


Query-DNA-Entry-Section

Query-DNA-Def read_036|beg|927|length|103|forward|gi
Query_DNA-Sequence
ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa

Coding-DNA-Entry-Section

Coding-DNA
atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa
Protein-Sequence
LSYARICPNPPRRNVRVKDCIKEH*S
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056


Query-DNA-Entry-Section

Query-DNA-Def read_037|beg|1378|length|0|reverse|gi
Query_DNA-Sequence
ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc

Coding-DNA-Entry-Section

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284


Query-DNA-Entry-Section

Query-DNA-Def read_041|beg|1320|length|0|reverse|gi
Query_DNA-Sequence
gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_045|beg|1544|length|108|forward|gi
Query_DNA-Sequence
tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_046|beg|21|length|137|forward|gi
Query_DNA-Sequence
taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc

Coding-DNA-Entry-Section

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639


Query-DNA-Entry-Section

Query-DNA-Def read_047|beg|1222|length|0|reverse|gi
Query_DNA-Sequence
atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_049|beg|969|length|0|reverse|gi
Query_DNA-Sequence
aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc

Coding-DNA-Entry-Section

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202


Query-DNA-Entry-Section

Query-DNA-Def read_053|beg|875|length|143|forward|gi
Query_DNA-Sequence
ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat

Coding-DNA-Entry-Section

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064


Query-DNA-Entry-Section

Query-DNA-Def read_055|beg|880|length|139|forward|gi
Query_DNA-Sequence
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt

Coding-DNA-Entry-Section

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137


Query-DNA-Entry-Section

Query-DNA-Def read_057|beg|596|length|139|forward|gi
Query_DNA-Sequence
ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_060|beg|428|length|133|forward|gi
Query_DNA-Sequence
cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct

Coding-DNA-Entry-Section

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251


Query-DNA-Entry-Section

Query-DNA-Def read_061|beg|941|length|104|forward|gi
Query_DNA-Sequence
tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_067|beg|463|length|139|forward|gi
Query_DNA-Sequence
gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt

Coding-DNA-Entry-Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM
Hit-Information Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG
Hit-Information Section
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283


Query-DNA-Entry-Section

Query-DNA-Def read_068|beg|832|length|108|forward|gi
Query_DNA-Sequence
tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa

Coding-DNA-Entry-Section

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161


Query-DNA-Entry-Section

Query-DNA-Def read_069|beg|1530|length|127|forward|gi
Query_DNA-Sequence
taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca

Coding-DNA-Entry-Section

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595


Query-DNA-Entry-Section

Query-DNA-Def read_071|beg|1193|length|126|forward|gi
Query_DNA-Sequence
cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_074|beg|1168|length|132|forward|gi
Query_DNA-Sequence
ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct

Coding-DNA-Entry-Section

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927


Query-DNA-Entry-Section

Query-DNA-Def read_075|beg|616|length|127|forward|gi
Query_DNA-Sequence
gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_076|beg|257|length|108|forward|gi
Query_DNA-Sequence
actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg

Coding-DNA-Entry-Section

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341


Query-DNA-Entry-Section

Query-DNA-Def read_077|beg|136|length|118|forward|gi
Query_DNA-Sequence
gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc

Coding-DNA-Entry-Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def read_079|beg|399|length|135|forward|gi
Query_DNA-Sequence
taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc

Coding-DNA-Entry-Section

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961


Query-DNA-Entry-Section

Query-DNA-Def read_080|beg|172|length|104|forward|gi
Query_DNA-Sequence
gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta

Coding-DNA-Entry-Section

Coding-DNA
aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat
Protein-Sequence
ILREELGFNDIHIIYSGRGYPY*S
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989


Query-DNA-Entry-Section

Query-DNA-Def read_084|beg|1347|length|139|forward|gi
Query_DNA-Sequence
ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_085|beg|335|length|106|forward|gi
Query_DNA-Sequence
gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa

Coding-DNA-Entry-Section

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341


Query-DNA-Entry-Section

Query-DNA-Def read_086|beg|1748|length|127|forward|gi
Query_DNA-Sequence
aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_088|beg|1859|length|137|forward|gi
Query_DNA-Sequence
cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_089|beg|41|length|136|forward|gi
Query_DNA-Sequence
gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_093|beg|1523|length|115|forward|gi
Query_DNA-Sequence
gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat

Coding-DNA-Entry-Section

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679


Query-DNA-Entry-Section

Query-DNA-Def read_094|beg|1505|length|137|forward|gi
Query_DNA-Sequence
tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa

Coding-DNA-Entry-Section

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242


Query-DNA-Entry-Section

Query-DNA-Def read_096|beg|1310|length|123|forward|gi
Query_DNA-Sequence
ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_098|beg|863|length|112|forward|gi
Query_DNA-Sequence
ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattatttatcggtaaaatttcctcagttTattactctaatgtcctttata

Coding-DNA-Entry-Section

Coding-DNA
tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt
Protein-Sequence
IIEAANRCSPPLFRGSNPMRSR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977


Query-DNA-Entry-Section

Query-DNA-Def read_100|beg|1440|length|113|forward|gi
Query_DNA-Sequence
cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_101|beg|1647|length|122|forward|gi
Query_DNA-Sequence
tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_102|beg|1434|length|133|forward|gi
Query_DNA-Sequence
ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_103|beg|447|length|134|forward|gi
Query_DNA-Sequence
ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_104|beg|1722|length|102|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa

Coding-DNA-Entry-Section

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824


Query-DNA-Entry-Section

Query-DNA-Def read_106|beg|346|length|125|forward|gi
Query_DNA-Sequence
caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_108|beg|341|length|104|forward|gi
Query_DNA-Sequence
gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac

Coding-DNA-Entry-Section

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296


Query-DNA-Entry-Section

Query-DNA-Def read_114|beg|1699|length|124|forward|gi
Query_DNA-Sequence
aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_115|beg|897|length|131|forward|gi
Query_DNA-Sequence
gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct

Coding-DNA-Entry-Section

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119


Query-DNA-Entry-Section

Query-DNA-Def read_116|beg|1617|length|129|forward|gi
Query_DNA-Sequence
gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg

Coding-DNA-Entry-Section

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156


Query-DNA-Entry-Section

Query-DNA-Def read_121|beg|748|length|141|forward|gi
Query_DNA-Sequence
ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc

Coding-DNA-Entry-Section

Coding-DNA
ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg
Protein-Sequence
PGGISAVFEARICCIIQIRGGTRYS*S
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837


Query-DNA-Entry-Section

Query-DNA-Def read_122|beg|1722|length|112|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg

Coding-DNA-Entry-Section

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440


Query-DNA-Entry-Section

Query-DNA-Def read_123|beg|1128|length|128|forward|gi
Query_DNA-Sequence
gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc

Coding-DNA-Entry-Section

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216


Query-DNA-Entry-Section

Query-DNA-Def read_124|beg|1098|length|129|forward|gi
Query_DNA-Sequence
taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_128|beg|232|length|102|forward|gi
Query_DNA-Sequence
atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc

Coding-DNA-Entry-Section

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429


Query-DNA-Entry-Section

Query-DNA-Def read_129|beg|1356|length|127|forward|gi
Query_DNA-Sequence
catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt

Coding-DNA-Entry-Section

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515


Query-DNA-Entry-Section

Query-DNA-Def read_130|beg|551|length|135|forward|gi
Query_DNA-Sequence
caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_131|beg|98|length|123|forward|gi
Query_DNA-Sequence
gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac

Coding-DNA-Entry-Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg
Protein-Sequence
SFLNSSTSSISLAETNDKNSFPWTSNLA*G
Hit-Information Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT
Protein-Sequence
MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241


Query-DNA-Entry-Section

Query-DNA-Def read_132|beg|1398|length|126|forward|gi
Query_DNA-Sequence
actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct

Coding-DNA-Entry-Section

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599


Query-DNA-Entry-Section

Query-DNA-Def read_133|beg|369|length|134|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc
Protein-Sequence
HLCQRRVQSLTHPSISWGF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081

Coding-DNA
gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta
Protein-Sequence
SATLGINGIGGLWPLCNLRDP*C
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081


Query-DNA-Entry-Section

Query-DNA-Def read_135|beg|1183|length|133|forward|gi
Query_DNA-Sequence
ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag

Coding-DNA-Entry-Section

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP
Hit-Information Section
gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def read_137|beg|1246|length|108|forward|gi
Query_DNA-Sequence
gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_142|beg|1222|length|137|forward|gi
Query_DNA-Sequence
ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_143|beg|627|length|102|forward|gi
Query_DNA-Sequence
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299


Query-DNA-Entry-Section

Query-DNA-Def read_144|beg|667|length|113|forward|gi
Query_DNA-Sequence
tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag

Coding-DNA-Entry-Section

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350


Query-DNA-Entry-Section

Query-DNA-Def read_145|beg|787|length|130|forward|gi
Query_DNA-Sequence
aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg

Coding-DNA-Entry-Section

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179


Query-DNA-Entry-Section

Query-DNA-Def read_148|beg|628|length|104|forward|gi
Query_DNA-Sequence
tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def read_149|beg|1569|length|117|forward|gi
Query_DNA-Sequence
catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_150|beg|956|length|110|forward|gi
Query_DNA-Sequence
ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta

Coding-DNA-Entry-Section

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062


Query-DNA-Entry-Section

Query-DNA-Def read_151|beg|401|length|136|forward|gi
Query_DNA-Sequence
accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct

Coding-DNA-Entry-Section

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169


Query-DNA-Entry-Section

Query-DNA-Def read_153|beg|598|length|141|forward|gi
Query_DNA-Sequence
ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg

Coding-DNA-Entry-Section

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748


Query-DNA-Entry-Section

Query-DNA-Def read_159|beg|1496|length|140|forward|gi
Query_DNA-Sequence
tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def read_161|beg|141|length|122|forward|gi
Query_DNA-Sequence
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc

Coding-DNA-Entry-Section

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522


Query-DNA-Entry-Section

Query-DNA-Def read_165|beg|1453|length|137|forward|gi
Query_DNA-Sequence
ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg

Coding-DNA-Entry-Section

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360


Query-DNA-Entry-Section

Query-DNA-Def read_167|beg|1547|length|107|forward|gi
Query_DNA-Sequence
ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_001|beg|888|length|144|forward|gi
Query_DNA-Sequence
caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc

Coding-DNA-Entry-Section

Coding-DNA
tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtggg
Protein-Sequence
GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWV
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613
gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_002|beg|758|length|128|forward|gi
Query_DNA-Sequence
ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt

Coding-DNA-Entry-Section

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_003|beg|1382|length|0|reverse|gi
Query_DNA-Sequence
ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_005|beg|1748|length|0|reverse|gi
Query_DNA-Sequence
gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag

Coding-DNA-Entry-Section

Coding-DNA
taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt
Protein-Sequence
KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF
Hit-Information Section
gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_007|beg|433|length|0|reverse|gi
Query_DNA-Sequence
ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_009|beg|558|length|0|reverse|gi
Query_DNA-Sequence
ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_011|beg|1241|length|142|forward|gi
Query_DNA-Sequence
agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_012|beg|1105|length|116|forward|gi
Query_DNA-Sequence
agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg

Coding-DNA-Entry-Section

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_013|beg|1597|length|0|reverse|gi
Query_DNA-Sequence
cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt

Coding-DNA-Entry-Section

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_017|beg|1014|length|130|forward|gi
Query_DNA-Sequence
ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_019|beg|1097|length|125|forward|gi
Query_DNA-Sequence
ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg

Coding-DNA-Entry-Section

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_020|beg|737|length|114|forward|gi
Query_DNA-Sequence
ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc

Coding-DNA-Entry-Section

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_023|beg|307|length|113|forward|gi
Query_DNA-Sequence
tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg

Coding-DNA-Entry-Section

Coding-DNA
ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg
Protein-Sequence
FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686
gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_024|beg|1651|length|104|forward|gi
Query_DNA-Sequence
tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_026|beg|1|length|117|forward|gi
Query_DNA-Sequence
tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_027|beg|980|length|135|forward|gi
Query_DNA-Sequence
accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_029|beg|787|length|99|forward|gi
Query_DNA-Sequence
aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct

Coding-DNA-Entry-Section

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_030|beg|369|length|133|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_031|beg|1449|length|127|forward|gi
Query_DNA-Sequence
gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat

Coding-DNA-Entry-Section

Coding-DNA
ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg
Protein-Sequence
LELVKKANLIIYSERLKRK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_032|beg|1594|length|105|forward|gi
Query_DNA-Sequence
caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_034|beg|1680|length|114|forward|gi
Query_DNA-Sequence
tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga

Coding-DNA-Entry-Section

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_035|beg|403|length|141|forward|gi
Query_DNA-Sequence
catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga

Coding-DNA-Entry-Section

Coding-DNA
ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga
Protein-Sequence
SSRSLNVSILVFPVTRPLSR
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 6 from: 172424 to: 172495
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_036|beg|927|length|103|forward|gi
Query_DNA-Sequence
ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa

Coding-DNA-Entry-Section

Coding-DNA
atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa
Protein-Sequence
LSYARICPNPPRRNVRVKDCIKEH*S
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_039|beg|348|length|135|forward|gi
Query_DNA-Sequence
ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc

Coding-DNA-Entry-Section

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_044|beg|1656|length|107|forward|gi
Query_DNA-Sequence
gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_045|beg|1544|length|108|forward|gi
Query_DNA-Sequence
tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_046|beg|21|length|137|forward|gi
Query_DNA-Sequence
taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc

Coding-DNA-Entry-Section

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_048|beg|1471|length|136|forward|gi
Query_DNA-Sequence
atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_050|beg|1088|length|119|forward|gi
Query_DNA-Sequence
aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc

Coding-DNA-Entry-Section

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_053|beg|875|length|143|forward|gi
Query_DNA-Sequence
ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat

Coding-DNA-Entry-Section

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_055|beg|880|length|139|forward|gi
Query_DNA-Sequence
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt

Coding-DNA-Entry-Section

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_057|beg|596|length|139|forward|gi
Query_DNA-Sequence
ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_060|beg|428|length|133|forward|gi
Query_DNA-Sequence
cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct

Coding-DNA-Entry-Section

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_061|beg|941|length|104|forward|gi
Query_DNA-Sequence
tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_067|beg|463|length|139|forward|gi
Query_DNA-Sequence
gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt

Coding-DNA-Entry-Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM
Hit-Information Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG
Hit-Information Section
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_068|beg|832|length|108|forward|gi
Query_DNA-Sequence
tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa

Coding-DNA-Entry-Section

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_069|beg|1530|length|127|forward|gi
Query_DNA-Sequence
taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca

Coding-DNA-Entry-Section

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_071|beg|1193|length|126|forward|gi
Query_DNA-Sequence
cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_074|beg|1168|length|132|forward|gi
Query_DNA-Sequence
ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct

Coding-DNA-Entry-Section

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_075|beg|616|length|127|forward|gi
Query_DNA-Sequence
gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_076|beg|257|length|108|forward|gi
Query_DNA-Sequence
actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg

Coding-DNA-Entry-Section

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_077|beg|136|length|118|forward|gi
Query_DNA-Sequence
gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc

Coding-DNA-Entry-Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_079|beg|399|length|135|forward|gi
Query_DNA-Sequence
taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc

Coding-DNA-Entry-Section

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_080|beg|172|length|104|forward|gi
Query_DNA-Sequence
gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta

Coding-DNA-Entry-Section

Coding-DNA
aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat
Protein-Sequence
ILREELGFNDIHIIYSGRGYPY*S
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_084|beg|1347|length|139|forward|gi
Query_DNA-Sequence
ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_085|beg|335|length|106|forward|gi
Query_DNA-Sequence
gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa

Coding-DNA-Entry-Section

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_086|beg|1748|length|127|forward|gi
Query_DNA-Sequence
aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_088|beg|1859|length|137|forward|gi
Query_DNA-Sequence
cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_089|beg|41|length|136|forward|gi
Query_DNA-Sequence
gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_093|beg|1523|length|115|forward|gi
Query_DNA-Sequence
gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat

Coding-DNA-Entry-Section

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_094|beg|1505|length|137|forward|gi
Query_DNA-Sequence
tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa

Coding-DNA-Entry-Section

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_096|beg|1310|length|123|forward|gi
Query_DNA-Sequence
ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_098|beg|863|length|112|forward|gi
Query_DNA-Sequence
ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattaTttatcggtaaaatttcctcagttTattactctaatgtcctttata

Coding-DNA-Entry-Section

Coding-DNA
tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt
Protein-Sequence
IIEAANRCSPPLFRGSNPMRSR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_100|beg|1440|length|113|forward|gi
Query_DNA-Sequence
cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_101|beg|1647|length|122|forward|gi
Query_DNA-Sequence
tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_102|beg|1434|length|133|forward|gi
Query_DNA-Sequence
ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_103|beg|447|length|134|forward|gi
Query_DNA-Sequence
ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_104|beg|1722|length|102|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa

Coding-DNA-Entry-Section

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_106|beg|346|length|125|forward|gi
Query_DNA-Sequence
caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_108|beg|341|length|104|forward|gi
Query_DNA-Sequence
gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac

Coding-DNA-Entry-Section

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_114|beg|1699|length|124|forward|gi
Query_DNA-Sequence
aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_115|beg|897|length|131|forward|gi
Query_DNA-Sequence
gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct

Coding-DNA-Entry-Section

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_116|beg|1617|length|129|forward|gi
Query_DNA-Sequence
gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg

Coding-DNA-Entry-Section

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_121|beg|748|length|141|forward|gi
Query_DNA-Sequence
ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc

Coding-DNA-Entry-Section

Coding-DNA
ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg
Protein-Sequence
PGGISAVFEARICCIIQIRGGTRYS*S
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_122|beg|1722|length|112|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg

Coding-DNA-Entry-Section

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_123|beg|1128|length|128|forward|gi
Query_DNA-Sequence
gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc

Coding-DNA-Entry-Section

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_124|beg|1098|length|129|forward|gi
Query_DNA-Sequence
taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_128|beg|232|length|102|forward|gi
Query_DNA-Sequence
atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc

Coding-DNA-Entry-Section

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_129|beg|1356|length|127|forward|gi
Query_DNA-Sequence
catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt

Coding-DNA-Entry-Section

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_130|beg|551|length|135|forward|gi
Query_DNA-Sequence
caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_131|beg|98|length|123|forward|gi
Query_DNA-Sequence
gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac

Coding-DNA-Entry-Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg
Protein-Sequence
SFLNSSTSSISLAETNDKNSFPWTSNLA*G
Hit-Information Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT
Protein-Sequence
MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_132|beg|1398|length|126|forward|gi
Query_DNA-Sequence
actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct

Coding-DNA-Entry-Section

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_133|beg|369|length|134|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc
Protein-Sequence
HLCQRRVQSLTHPSISWGF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081

Coding-DNA
gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta
Protein-Sequence
SATLGINGIGGLWPLCNLRDP*C
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_135|beg|1183|length|133|forward|gi
Query_DNA-Sequence
ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag

Coding-DNA-Entry-Section

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP
Hit-Information Section
gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_137|beg|1246|length|108|forward|gi
Query_DNA-Sequence
gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_142|beg|1222|length|137|forward|gi
Query_DNA-Sequence
ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_143|beg|627|length|102|forward|gi
Query_DNA-Sequence
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_144|beg|667|length|113|forward|gi
Query_DNA-Sequence
tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag

Coding-DNA-Entry-Section

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_145|beg|787|length|130|forward|gi
Query_DNA-Sequence
aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg

Coding-DNA-Entry-Section

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_148|beg|628|length|104|forward|gi
Query_DNA-Sequence
tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_149|beg|1569|length|117|forward|gi
Query_DNA-Sequence
catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_150|beg|956|length|110|forward|gi
Query_DNA-Sequence
ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta

Coding-DNA-Entry-Section

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_151|beg|401|length|136|forward|gi
Query_DNA-Sequence
accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct

Coding-DNA-Entry-Section

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_153|beg|598|length|141|forward|gi
Query_DNA-Sequence
ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg

Coding-DNA-Entry-Section

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_159|beg|1496|length|140|forward|gi
Query_DNA-Sequence
tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_161|beg|141|length|122|forward|gi
Query_DNA-Sequence
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc

Coding-DNA-Entry-Section

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_165|beg|1453|length|137|forward|gi
Query_DNA-Sequence
ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg

Coding-DNA-Entry-Section

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_167|beg|1547|length|107|forward|gi
Query_DNA-Sequence
ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc

Coding-DNA-Entry-Section

Coding-DNA
tcacaagttcgagttctatTaccatagggtgagtaggatagggcccccc
Protein-Sequence
HKFEFYYHRVSRIGPP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 173566 to: 173595

Coding-DNA
tcacaagttcgagttctatTaccatagggtgagtaggatagggcccccc
Protein-Sequence
HKFEFYYHRVSRIGPP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 173566 to: 173595


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_001|beg|2512|length|120|forward|gi
Query_DNA-Sequence
tctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttgacc

Coding-DNA-Entry-Section

Coding-DNA
ctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttga
Protein-Sequence
GQGDGERNKIFAEAFGRDAEFFAFYRAMQAYETAFNWWNR
Hit-Information Section
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417142 to: 2417237
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610373 to: 3610468


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_002|beg|2211|length|144|forward|gi
Query_DNA-Sequence
caaaaaatataataaaataattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccacttcttaatttgtgaatcTtttatcatctTccatttttttttaacat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_007|beg|268|length|107|forward|gi
Query_DNA-Sequence
taaattcagatttagtcttagctaaccaatcatacatagatatattgtataagatttaatctcataagctcttatggactttggtatcatttggatcaaatttgtct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_011|beg|1665|length|122|forward|gi
Query_DNA-Sequence
tgtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt

Coding-DNA-Entry-Section

Coding-DNA
gtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt
Protein-Sequence
KQELGDWVIAIGNPFGLGGTVTAGIIQQEIDQSDCLRYKL
Hit-Information Section
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887137 to: 1887214
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 2 from: 2802806 to: 2802883
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355953 to: 1356030
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349251 to: 1349328
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8553 to: 8630
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367346 to: 1367423
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364496 to: 1364573
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 489285 to: 489362
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836329 to: 2836406
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456492 to: 3456569
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165081 to: 7165158
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785844 to: 5785915
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683226 to: 683303
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219544 to: 3219621
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322989 to: 6323066
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 3168642 to: 3168713
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946774 to: 2946851
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757259 to: 5757336
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151682 to: 2151759
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418444 to: 2418521
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250103 to: 2250180
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713911 to: 3713988
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997510 to: 1997587
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609103 to: 3609180
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3949530 to: 3949607
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168194 to: 1168262
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320873 to: 2320950
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246280 to: 246357
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 550628 to: 550705
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71227 to: 71304
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62585 to: 62662
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 848 to: 925
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 821 to: 898
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667639 to: 1667716
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 2 from: 164754 to: 164825
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432575 to: 432640
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367887 to: 6367964
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211350 to: 1211427
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 3977259 to: 3977324
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663790 to: 2663867
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 1013990 to: 1014058
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617902 to: 2617979
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552048 to: 3552125
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917630 to: 3917698
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625378 to: 1625455
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 3004488 to: 3004565
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340230 to: 1340298
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294304 to: 2294381
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266551 to: 266619
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170820 to: 170888
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497381 to: 1497449
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 3402718 to: 3402786
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991977 to: 992045
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1866553 to: 1866621
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5742 to: 5819
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966525 to: 966602
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 2002161 to: 2002229
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556193 to: 2556261
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563305 to: 1563382
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 2 from: 867750 to: 867815
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973562 to: 2973639
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302025 to: 1302102
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205095 to: 2205163
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 1038097 to: 1038165
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99410 to: 99487
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69430 to: 69507
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838175 to: 3838243
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1347106 to: 1347171
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 464956 to: 465033
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434048 to: 434119
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360580 to: 2360648
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933533 to: 1933604
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6508 to: 6576
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 1481604 to: 1481672
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472412 to: 1472477
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119358 to: 1119435
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299953 to: 300030
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 525 to: 596
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360485 to: 360556
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 812523 to: 812594
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209940 to: 1210008
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455231 to: 2455302
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193379 to: 1193447
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206735 to: 1206803
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852865 to: 852936
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707251 to: 1707316
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968960 to: 969028
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730842 to: 4730913
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 752 to: 820
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227875 to: 3227946
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192123 to: 2192200
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634431 to: 634499
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970353 to: 970424
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79057 to: 79128
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967615 to: 967686
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927065 to: 927130
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881028 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90043
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273794 to: 273865
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219050 to: 219121
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946806 to: 946877
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246511 to: 246582
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124538 to: 1124609
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120943 to: 1121014
gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 896671 to: 896742
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576887 to: 576955
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725706 to: 1725771
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427034 to: 427102
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780576 to: 1780644
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799750 to: 2799818
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750324 to: 2750392
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837587 to: 2837655
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462275 to: 2462343
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564603 to: 564671
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210100 to: 3210168
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 501552 to: 501617
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647528
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777118
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2244783 to: 2244854
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939965 to: 2940033
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934462 to: 1934530
gi-nr: gi|33238865 gi_def: Prochlorococcus marinus subsp. marinus str. CCMP1375 complete genome hsp_num: 1 from: 116489 to: 116560
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 1119186 to: 1119251
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3095258 to: 3095326
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696481 to: 696546
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 2 from: 754658 to: 754723
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 3267195 to: 3267266
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 559 to: 627
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978033 to: 3978101
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7924 to: 7992
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 953 to: 1021
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242058 to: 242126
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249322 to: 249390
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242049 to: 242117
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241163 to: 241231
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 335 to: 373
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829861 to: 829929
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619717 to: 3619785
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239147 to: 3239215
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913587 to: 3913655
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651877 to: 3651945
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796537 to: 796605
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903457 to: 3903525
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259710 to: 259778
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343281 to: 1343352
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428584 to: 1428649
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1933 to: 1998
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688687 to: 688752
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087596 to: 4087664
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 3457286 to: 3457351
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253502 to: 253570
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142957 to: 143022
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79450 to: 79515
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146093 to: 146158
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 1583819 to: 1583884
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252713 to: 252781
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502816 to: 2502884
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1374 to: 1442
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531144 to: 531212
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369821 to: 369889
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53608 to: 53679
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979313 to: 3979381
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350811 to: 4350879
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481613 to: 2481678
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189185 to: 4189253
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935880 to: 3935948
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149077 to: 149145
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180877 to: 4180945
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16885 to: 16953
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 100 to: 138
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264307
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264227 to: 1264265
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 514 to: 582
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767214 to: 5767279
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808372 to: 808437
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238515
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147992 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147452 to: 147490
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914076 to: 914141
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4770 to: 4808
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191807
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226813 to: 226881


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_012|beg|1640|length|134|forward|gi
Query_DNA-Sequence
gagtttattgTatgcatcagtttgaatgtaatcttTcaTtaacgagacagtTccgattgatcTtatttcttgctgatattattcctcagtaaccgttcctcctaagccaaaggggattgccgattgcgataacc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_013|beg|638|length|128|forward|gi
Query_DNA-Sequence
atataaatgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttgtaaacctgcatactgtTcggattgatgattttctccttcaatttttttttgcaatctta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_014|beg|1004|length|113|forward|gi
Query_DNA-Sequence
taatctattgggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_015|beg|776|length|109|forward|gi
Query_DNA-Sequence
tgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagTcttaacaccaatatatcTttcttggttttgattattgtaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_016|beg|2747|length|104|forward|gi
Query_DNA-Sequence
tctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc

Coding-DNA-Entry-Section

Coding-DNA
ctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc
Protein-Sequence
ESFGIKIVDVRIKRADLPQANSDAIYRRIRLKGK
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797881 to: 797970
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205782 to: 1205871
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 11010 to: 11093
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011138 to: 1011221
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353700 to: 1353789
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080087 to: 1080176
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 582399 to: 582482
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2619018 to: 2619065


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_017|beg|456|length|117|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaatttttaactagTtccattgattaatgattgaaaatatagacctgttccaccTaactaaaattggaattttttttctttttttTgaatat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_018|beg|2521|length|119|forward|gi
Query_DNA-Sequence
caaTttaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaatttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTcaccttgacccTttcatg

Coding-DNA-Entry-Section

Coding-DNA
ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc
Protein-Sequence
NLHLFQRLLQKILFLSPF
Hit-Information Section
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107

Coding-DNA
ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc
Protein-Sequence
NLHLFQRLLQKILFLSPF
Hit-Information Section
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_020|beg|1843|length|119|forward|gi
Query_DNA-Sequence
gactgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgattaa

Coding-DNA-Entry-Section

Coding-DNA
actgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgatt
Protein-Sequence
LQYQDKGSAPTTVALYSLSPSTRTKISSAFCNNMIVSD*
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_024|beg|2741|length|116|forward|gi
Query_DNA-Sequence
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaacatctactattttaattccaaaactttcagct

Coding-DNA-Entry-Section

Coding-DNA
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca
Protein-Sequence
MLELKEADLPQSNSDAIYRRMQTEREREA
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197
gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77

Coding-DNA
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca
Protein-Sequence
MLELKEADLPQSNSDAIYRRMQTEREREA
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197
gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_025|beg|2094|length|123|forward|gi
Query_DNA-Sequence
ttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacTttattgcaaaa

Coding-DNA-Entry-Section

Coding-DNA
tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISTTTTVTT
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286

Coding-DNA
tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISTTTTVTT
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_026|beg|2198|length|139|forward|gi
Query_DNA-Sequence
gcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaactttttatataccaataattataaaaaccTtataactgcaaaaattaacccaccacttcttaattgtgaatcttttaTtcTatc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_027|beg|1217|length|117|forward|gi
Query_DNA-Sequence
gtaatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatttttcatctctttaatcttagtgttattaaactcta

Coding-DNA-Entry-Section

Coding-DNA
taatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatt
Protein-Sequence
NLSFISPDFNIYYVLPTSVCATIIGKF
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_028|beg|32|length|137|forward|gi
Query_DNA-Sequence
aattgatattaactTcttctgcttTcatccaaggtaaTtttcatcaTtttagatTactgtgtcaattcggcaatcccaaTttaccttgtttacactctgatTcttttttaatttttagtttaagaaattttttaact

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_029|beg|2108|length|115|forward|gi
Query_DNA-Sequence
gtcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgaaaacttattgcaaaaaatataata

Coding-DNA-Entry-Section

Coding-DNA
tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISKR
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286

Coding-DNA
tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISKR
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_030|beg|1689|length|105|forward|gi
Query_DNA-Sequence
cgattgatctatttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataacccaatcaccaattcttgcttgatcTagaa

Coding-DNA-Entry-Section

Coding-DNA
tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc
Protein-Sequence
LGYAIGNPFGLGGTVTAGIISKK*I
Hit-Information Section
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792
gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209
gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529
gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973
gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 2663817 to: 2663870
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2961597 to: 2961650
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606
gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656
gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325
gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172
gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648
gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573
gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784
gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285
gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779
gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658
gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455
gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695
gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634
gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686
gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616
gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670
gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876
gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886
gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378
gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585
gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586
gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726
gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581
gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227
gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696
gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959
gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755
gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415
gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669
gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666
gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195
gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595
gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162
gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389
gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876
gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411
gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034
gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890
gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780
gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440
gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515
gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335
gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251
gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519
gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488
gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448
gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602
gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869
gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423
gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002
gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779
gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739
gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130
gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368
gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769

Coding-DNA
tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc
Protein-Sequence
LGYAIGNPFGLGGTVTAGIISKK*I
Hit-Information Section
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792
gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209
gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529
gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973
gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 2663817 to: 2663870
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2961597 to: 2961650
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606
gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656
gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325
gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172
gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648
gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573
gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784
gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285
gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779
gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658
gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455
gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695
gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634
gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686
gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616
gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670
gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876
gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886
gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378
gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585
gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586
gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726
gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581
gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227
gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696
gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959
gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755
gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415
gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669
gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666
gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195
gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595
gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162
gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389
gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876
gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411
gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034
gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890
gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780
gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440
gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515
gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335
gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251
gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519
gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488
gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448
gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602
gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869
gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423
gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002
gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779
gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739
gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130
gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368
gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_031|beg|835|length|130|forward|gi
Query_DNA-Sequence
ttaatctagcttaacaccaatTatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgattagaTttttaaaacagtTgcctacaatatcttcaagatctttagtagattttatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_033|beg|443|length|110|forward|gi
Query_DNA-Sequence
tagtctaactttatttctaaacttaagaggtatctctggaattttaatagtccattgatttaatgattgaaaatatagacctgttccaccaactaaaattggaatttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_034|beg|1399|length|104|forward|gi
Query_DNA-Sequence
tgctcctctaggttcatctaatttttcaacttcaTgcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcTaccaaattctat

Coding-DNA-Entry-Section

Coding-DNA
aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt
Protein-Sequence
MVETKRGWLGVRIQVVSEEIA
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 5432 to: 5488
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448

Coding-DNA
aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt
Protein-Sequence
MVETKRGWLGVRIQVVSEEIA
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 5432 to: 5488
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_035|beg|275|length|111|forward|gi
Query_DNA-Sequence
agatttagtcttagctaaccaatcatacatagatatatttgtataagatttaatctcataaTgctcttatggatctttgagtatcattttTggatcaaatttgTtctttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_036|beg|2480|length|133|forward|gi
Query_DNA-Sequence
gaattcactgtcagggtgataaaattaaagatTgtctgtccaccaattaaagcagtttcataggcttgcatcgcTtctgtagaaagcaaaaaattctgcatctcttccaaaaggcttctgcaaagatcttatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_043|beg|1462|length|127|forward|gi
Query_DNA-Sequence
aacacccagccatcctcttttagttttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagagccTacctttacccaaaattgctgtgt

Coding-DNA-Entry-Section

Coding-DNA
tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag
Protein-Sequence
GSIGIGFSIPSNDAKRVVNQLIEFGE
Hit-Information Section
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912
gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282

Coding-DNA
tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag
Protein-Sequence
GSIGIGFSIPSNDAKRVVNQLIEFGE
Hit-Information Section
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912
gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_044|beg|2597|length|122|forward|gi
Query_DNA-Sequence
aaagatcttatttctttcaccatcaccttgaccccttcatTatttcagattctttattagcatttgctaaaattacagaaacatctttgtctgcagttgaagtaattgtaaccgccatctct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_045|beg|1646|length|133|forward|gi
Query_DNA-Sequence
attgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccaa

Coding-DNA-Entry-Section

Coding-DNA
ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca
Protein-Sequence
GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS
Hit-Information Section
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383
gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066
gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057
gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972
gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462
gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297

Coding-DNA
ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca
Protein-Sequence
GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS
Hit-Information Section
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383
gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066
gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057
gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972
gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462
gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_048|beg|1081|length|128|forward|gi
Query_DNA-Sequence
atcttcatcattcaatggtcttacaattatttttaaagatttaatttcagaaattttcaggtgtttcttctttagtttcttttttttctactttaaaatccctctgaagtttcaagtcttcctagttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_049|beg|1380|length|127|forward|gi
Query_DNA-Sequence
ctgcaacactagTcaactaatgctcctctaggttcatctaatttttcTaacttcagcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa

Coding-DNA-Entry-Section

Coding-DNA
gcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa
Protein-Sequence
LIEFGETKRGWLGVRIQVVSEENC*S
Hit-Information Section
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69154 to: 69219
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6232 to: 6297
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001885 to: 2001950
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866277 to: 1866342
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065284 to: 2065349
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195428 to: 195493
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057219 to: 2057284
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396056 to: 1396121
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209735 to: 3209800
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887425 to: 1887490
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402442 to: 3402507
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904832 to: 904897
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117885 to: 2117950
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085398 to: 2085463
gi-nr: gi|2094849 gi_def: R.capsulatus fdxE gene hsp_num: 1 from: 1102 to: 1152


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_052|beg|57|length|110|forward|gi
Query_DNA-Sequence
tccaaggtaatttcatatttagatactgtgtcaattcggcaatcccaattaccttgtttacactctgatctttttaatttttTagtttaagaaattttttaaacttcaga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_053|beg|2036|length|110|forward|gi
Query_DNA-Sequence
aacatatcttcaaaaggtgatcctgggggaaactgaaaaccaggaaatggTatttagaatttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_054|beg|1446|length|104|forward|gi
Query_DNA-Sequence
aaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttTgcatcgttcatggtattggaaaaacc

Coding-DNA-Entry-Section

Coding-DNA
aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct
Protein-Sequence
MQKRVVNQLIEFGETKRGWLGVRIQVV
Hit-Information Section
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112

Coding-DNA
aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct
Protein-Sequence
MQKRVVNQLIEFGETKRGWLGVRIQVV
Hit-Information Section
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_055|beg|1556|length|113|forward|gi
Query_DNA-Sequence
atagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgagtttattgatgcatcagtttgTaatg

Coding-DNA-Entry-Section

Coding-DNA
tagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgag
Protein-Sequence
TQENSGGPLFDMNGDVIGINTAILGKGGS
Hit-Information Section
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176455 to: 8176526
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 2 from: 3517066 to: 3517137
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 5328805 to: 5328876
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 4 from: 1070315 to: 1070380
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5482594 to: 5482665
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887290 to: 1887364
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355803 to: 1355877
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349101 to: 1349175
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8706 to: 8780
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367196 to: 1367270
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364346 to: 1364420
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395921 to: 1395995
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389165 to: 1389227
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367253 to: 1367315
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354728 to: 1354790
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 661 to: 735
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065410 to: 2065484
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195554 to: 195628
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402568 to: 3402642
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6358 to: 6432
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909749 to: 2909823
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002011 to: 2002085
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556043 to: 2556117
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2989359 to: 2989430
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 365565 to: 365636
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69280 to: 69354
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 6049720 to: 6049797
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9948 to: 10007
gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 1734087 to: 1734161
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 688 to: 747
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012230 to: 1012289
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798982 to: 799041
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227725 to: 3227799
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515190 to: 3515261
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294445 to: 2294519
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 2987759 to: 2987821
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8023 to: 8097
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1210084 to: 1210155
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455093 to: 2455155
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16333 to: 16398
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888447 to: 888521
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958967 to: 4959038
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044380 to: 1044451
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1910105 to: 1910176
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548810 to: 1548881
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163662 to: 163736
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322611 to: 3322685
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355156 to: 3355230
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470794 to: 3470868
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391623 to: 391697
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 2 from: 2029969 to: 2030031
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349243 to: 349317
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190627 to: 190701
gi-nr: gi|2062623 gi_def: Mycobacterium tuberculosis sigma factor SigE (sigE) and HtrA (htrA) genes, complete cds hsp_num: 1 from: 3088 to: 3144
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316866 to: 2316928
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 3 from: 1040311 to: 1040373
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193523 to: 1193585
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1081119 to: 1081181
gi-nr: gi|32447713 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 22/24 hsp_num: 1 from: 37110 to: 37187
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 691053 to: 691112
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7720763 to: 7720825
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 5 from: 2481466 to: 2481525
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 6 from: 5421057 to: 5421116
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 7 from: 5699996 to: 5700058
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 3 from: 1234329 to: 1234391
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 3 from: 2622356 to: 2622418
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3858651 to: 3858722
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778195 to: 3778266
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127546 to: 1127617
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 92570 to: 92641
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4649671 to: 4649742
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 430500 to: 430559
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 1971130 to: 1971189
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 2 from: 301701 to: 301754
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 530991 to: 531065
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 369668 to: 369742
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3979460 to: 3979534
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 4350958 to: 4351032
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 4189032 to: 4189106
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 3936027 to: 3936101
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 149224 to: 149298
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 4181024 to: 4181098
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 688840 to: 688905
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 4 from: 3446891 to: 3446950
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 1 from: 27894 to: 27953
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 1 from: 27362 to: 27421
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 1 from: 332508 to: 332570
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 4 from: 1167588 to: 1167650
gi-nr: gi|32448029 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 23/24 hsp_num: 1 from: 213562 to: 213627
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 1 from: 600903 to: 600965
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035561 to: 1035623
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4315831 to: 4315884
gi-nr: gi|157313474 gi_def: Thermotoga lettingae TMO, complete genome hsp_num: 1 from: 426172 to: 426234
gi-nr: gi|149792434 gi_def: Thermosipho melanesiensis BI429, complete genome hsp_num: 1 from: 1781964 to: 1782026
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653436 to: 3653492
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170642 to: 5170698
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 4 from: 4084087 to: 4084146
gi-nr: gi|145358489 gi_def: Arabidopsis thaliana serine-type peptidase/ trypsin (AT5G27660) mRNA, complete cds hsp_num: 1 from: 902 to: 952
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 2 from: 4238430 to: 4238486
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 3 from: 922705 to: 922761
gi-nr: gi|125860746 gi_def: Methanoculleus marisnigri JR1, complete genome hsp_num: 1 from: 1350874 to: 1350936
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 4829762 to: 4829818
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 2 from: 4292609 to: 4292665
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 3 from: 944725 to: 944781
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 2 from: 4258127 to: 4258183
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 3 from: 938918 to: 938974
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 769134 to: 769193
gi-nr: gi|699111 gi_def: Mycobacterium leprae cosmid B1756 hsp_num: 1 from: 22206 to: 22262
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091738 to: 1091791
gi-nr: gi|145362659 gi_def: Arabidopsis thaliana DEGP8 (DEGP PROTEASE 8); serine-type peptidase/ trypsin (DEGP8) mRNA, complete cds hsp_num: 1 from: 957 to: 1016
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 3 from: 1071559 to: 1071612
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 1054235 to: 1054294
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 566585 to: 566644
gi-nr: gi|154152641 gi_def: Fervidobacterium nodosum Rt17-B1, complete genome hsp_num: 1 from: 1103306 to: 1103368
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 1 from: 4965950 to: 4966009
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 2 from: 5178264 to: 5178323
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1370796 to: 1370852
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1368340 to: 1368396
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1396752 to: 1396808
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5011660 to: 5011716
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1366518 to: 1366574
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 4 from: 5412814 to: 5412873
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 333243 to: 333299
gi-nr: gi|31617962 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 5/14 hsp_num: 1 from: 53674 to: 53730
gi-nr: gi|24427855 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 16/29 hsp_num: 1 from: 43612 to: 43671
gi-nr: gi|13092922 gi_def: Mycobacterium leprae strain TN complete genome; segment 4/10 hsp_num: 1 from: 241942 to: 241998
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 241283 to: 241342
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 2 from: 1583672 to: 1583731
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 2873145 to: 2873201
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 2 from: 426994 to: 427047
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 526 to: 579
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1039 to: 1092
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696340 to: 696399
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 1 from: 1123 to: 1176
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754517 to: 754576
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 988 to: 1041
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1084 to: 1137
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725853 to: 1725912
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 926924 to: 926983
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 718 to: 771
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 998 to: 1051
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 2 from: 338250 to: 338312


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_056|beg|1114|length|141|forward|gi
Query_DNA-Sequence
taaagatttaatttcagaaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTtctctcttttatttctccagattttaacatct

Coding-DNA-Entry-Section

Coding-DNA
aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt
Protein-Sequence
QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222

Coding-DNA
aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt
Protein-Sequence
QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_057|beg|769|length|112|forward|gi
Query_DNA-Sequence
caaaatttatttacctgatgcTagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagcttaacaccaatataTtcttctttggttttgattatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_058|beg|2464|length|120|forward|gi
Query_DNA-Sequence
taccTaaaaaatttaaagaattcactgtcaggtgataaaattTaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_059|beg|2772|length|139|forward|gi
Query_DNA-Sequence
ctataaattTgcatcactgtttgcttgtggaaggtccgctcttttaattTctaacatcTtactattttaattccaaaactttcagcttcagtattacaccttcttgtattaaagccatttgtttagttctgtcttttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_061|beg|1861|length|115|forward|gi
Query_DNA-Sequence
gggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttgaataacatgattgttagtgattacaattccactctcttc

Coding-DNA-Entry-Section

Coding-DNA
ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga
Protein-Sequence
DQHQQPSLYILYHHQLELKYLLHF*I
Hit-Information Section

Coding-DNA
ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga
Protein-Sequence
DQHQQPSLYILYHHQLELKYLLHF*I
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_062|beg|2286|length|121|forward|gi
Query_DNA-Sequence
actgcaaaaattaacccaccacttcttaattgtTgaatcttttatcatctccattttttttaacaTtactttttcatttttgatggaaataaggcatataaaattccttctataaaaagaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_064|beg|755|length|122|forward|gi
Query_DNA-Sequence
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgcttgtccattattaatctagcttaacaccaatatatcttctttggttttgat

Coding-DNA-Entry-Section

Coding-DNA
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt
Protein-Sequence
TSRSKIILISGPTASGKSNFAVKIA
Hit-Information Section
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167
gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855

Coding-DNA
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt
Protein-Sequence
TSRSKIILISGPTASGKSNFAVKIA
Hit-Information Section
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167
gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_065|beg|722|length|117|forward|gi
Query_DNA-Sequence
gtcggcattgatgattttccttcaatttttttgcaatcttaacagcaaaatttgatttaacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_066|beg|683|length|124|forward|gi
Query_DNA-Sequence
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaaatt

Coding-DNA-Entry-Section

Coding-DNA
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa
Protein-Sequence
ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA
Hit-Information Section
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766

Coding-DNA
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa
Protein-Sequence
ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA
Hit-Information Section
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_069|beg|2328|length|127|forward|gi
Query_DNA-Sequence
atcatctccattttttttaacatacttttcatttttgatggaaataaggcatataaaattccttctataaaaaagaaaaagtccaaaagctataattagctctttcattttttagattaattttggt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_071|beg|2837|length|121|forward|gi
Query_DNA-Sequence
aattccaaaactttcacttcagtaTtttacTaccttcttgtatttaaagccatttgtttagttctgtcttttgaaagtaaagtttgtaattcttgctgacctagtacatttctcagtcttg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_072|beg|154|length|120|forward|gi
Query_DNA-Sequence
ttttaacttcagaaatggctccattaTtttagcatgctagaagttcttaaattaattttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_073|beg|167|length|138|forward|gi
Query_DNA-Sequence
aatggctccattatttagcatgctagaagttcttaaattaattttttcaacaaTgcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaatcataca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_074|beg|1887|length|128|forward|gi
Query_DNA-Sequence
tatattctttatcaccatcaactcgaactaaaatatcttcTtgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttccttg

Coding-DNA-Entry-Section

Coding-DNA
agtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttcct
Protein-Sequence
RKSAALGSGFIIEESGNCNH*Q
Hit-Information Section
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835395 to: 1835442
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563083 to: 1563130
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165333 to: 7165380


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_076|beg|1506|length|120|forward|gi
Query_DNA-Sequence
gatttacaactctttttgcatcgttcgatggTtattgaaaaacctatccccTatagagccacctttacccaaaattgctgtgttaattccaattacatcaccattatatcaaataaaggt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_077|beg|74|length|117|forward|gi
Query_DNA-Sequence
atttagatactgtgtcaattcggcaatTcccaattaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatTggctccattatttagcatg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_078|beg|1251|length|129|forward|gi
Query_DNA-Sequence
ctacagttttaccaacttctgtttgtgcaacaattattggtaattctttcatcttttaatcttagtgttattaaaTctctaataTtTaatgtctcctgctttaattccgctttgtcagatgggctattt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_081|beg|2109|length|129|forward|gi
Query_DNA-Sequence
tcgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaatgaagtggtgcgtctttttgcaaacccttTgtgatgcaaactttattgTcaaaaaaataataaataattttttaat

Coding-DNA-Entry-Section

Coding-DNA
cgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaat
Protein-Sequence
FICGSGRKINAICCKLLQR
Hit-Information Section
gi-nr: gi|18997370 gi_def: Homo sapiens chromosome 1 clone RP3-445O10, complete sequence hsp_num: 2 from: 136366 to: 136413


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_086|beg|119|length|136|forward|gi
Query_DNA-Sequence
actctgatcttttttaattttttagtttaagaaaattttttaactttcagaaaatgggctccattatttagcatgcTtagaagttcttaaattaattttttcaacaagctttctctttttgtatcaatatgtagtt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_088|beg|917|length|106|forward|gi
Query_DNA-Sequence
aaaacagtgcctacaatatcttcaagatctttagtagattttattttttttcttttgagcttcaacaataaacatctccaacatttaagtaatctTattgggctat

Coding-DNA-Entry-Section

Coding-DNA
aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt
Protein-Sequence
NSAYNIFKIFSRFYFFS
Hit-Information Section

Coding-DNA
aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt
Protein-Sequence
NSAYNIFKIFSRFYFFS
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_091|beg|551|length|121|forward|gi
Query_DNA-Sequence
tttctttttttgaatattttcaatttttttaattgttagttctaaccattgtcccTattgaaaatttttcattttaaatcaacaaaTtTccatTataaatgatgtttaatatttttttgtt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_092|beg|2471|length|133|forward|gi
Query_DNA-Sequence
aaatttaaagaattcactgtcaggtgataaaattaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcctctgtagaaagcaaaaaattTctgcatctcttccaaaggcttctgcaaagatc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_094|beg|1072|length|106|forward|gi
Query_DNA-Sequence
ttgctcaaatatcttcatcattTcaatggtcttacaattatttttaaagatttaatttcagTaaatttcaTggtgtttcttctttagtttcttttttttctacttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_095|beg|2392|length|134|forward|gi
Query_DNA-Sequence
ctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattttttaggttttatgttaccaaaaaaatttaaagaattcTaTcttcaggtTgataaaaattaaagatgtctgtccac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_096|beg|169|length|103|forward|gi
Query_DNA-Sequence
tggctccattatttagcatgctagaagttcttTaaattaattttttcaacaagcttttctcttttgtatcaatatgtagttttaaaaagtcactatcattaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_097|beg|1751|length|139|forward|gi
Query_DNA-Sequence
ttgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggTtataaatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgcttta

Coding-DNA-Entry-Section

Coding-DNA
tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact
Protein-Sequence
PVKFGNSDQARIGDWVIAIGQ
Hit-Information Section
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545

Coding-DNA
aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct
Protein-Sequence
KATVVGADPLSDIAVLQIDSKKNL
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561
gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515
gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216

Coding-DNA
tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact
Protein-Sequence
PVKFGNSDQARIGDWVIAIGQ
Hit-Information Section
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545

Coding-DNA
aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct
Protein-Sequence
KATVVGADPLSDIAVLQIDSKKNL
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561
gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515
gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_099|beg|1365|length|143|forward|gi
Query_DNA-Sequence
cagatTgggTctattttctgcaacactagcaactaatgctcctctaggttcatctaatttttcaacttcagcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaaTttctatcaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_104|beg|2272|length|142|forward|gi
Query_DNA-Sequence
ttataaaacctataactgcaaaaattaacccaccacttcttaattgtgTaatcttttatcatctccattttttttaacatacttttcatttttgatggaaataaggcTatataaaattccttctataaaaagaaaaagtcca

Coding-DNA-Entry-Section

Coding-DNA
gtgTaatcttttatcatctccattttttttaacatacttttcatttttg
Protein-Sequence
LCNLLSSPFFLTYFSFL
Hit-Information Section
gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175

Coding-DNA
gtgTaatcttttatcatctccattttttttaacatacttttcatttttg
Protein-Sequence
LCNLLSSPFFLTYFSFL
Hit-Information Section
gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_107|beg|306|length|137|forward|gi
Query_DNA-Sequence
gatatatttgtataagaTtttaatcTtcataagctcttatggTatctttgagTtaTtcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtccttctttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_108|beg|846|length|108|forward|gi
Query_DNA-Sequence
taacTaccaatatatcttctttggttttgaTttattgtaaattacaatTcaaaaTtagttttttgattagattttaaaacagtgcctacaaTtatcttcaagatcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_110|beg|1087|length|134|forward|gi
Query_DNA-Sequence
atcattcaatggtcttacaattatttttaaagatttaatttcagaaatttaggtgTtttcttctttagtttcttttttttctacTtttaaatcctctgaagttttcaagtcttcctagtttaattttttttgta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_113|beg|1503|length|107|forward|gi
Query_DNA-Sequence
attatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattccaattacatcaccattc

Coding-DNA-Entry-Section

Coding-DNA
ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca
Protein-Sequence
LELTQQFWVKVASIGIGFSIPSNDAKRVVNN
Hit-Information Section
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746
gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 2909695 to: 2909745
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427
gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357
gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545

Coding-DNA
ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca
Protein-Sequence
LELTQQFWVKVASIGIGFSIPSNDAKRVVNN
Hit-Information Section
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746
gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 2909695 to: 2909745
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427
gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357
gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_117|beg|1566|length|122|forward|gi
Query_DNA-Sequence
ctttacccaaaattctgtgttaattccaattacatcaccattcatatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataaccgagaca

Coding-DNA-Entry-Section

Coding-DNA
atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa
Protein-Sequence
VMKITFKHMHQINSGNSGGPLFEYE
Hit-Information Section
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389153 to: 1389185
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367241 to: 1367273
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354716 to: 1354748
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575
gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167
gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586
gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097
gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637
gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773
gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675
gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774
gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219
gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782
gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612
gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666
gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830
gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212
gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893
gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122
gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663
gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539
gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156
gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590
gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394
gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490
gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957
gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398
gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514
gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631
gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945
gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648
gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734
gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587
gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265
gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290
gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151
gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582
gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122
gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879
gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899
gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071
gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905
gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035
gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891
gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995
gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008
gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034

Coding-DNA
atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa
Protein-Sequence
VMKITFKHMHQINSGNSGGPLFEYE
Hit-Information Section
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389153 to: 1389185
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367241 to: 1367273
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354716 to: 1354748
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575
gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167
gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586
gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097
gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637
gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773
gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675
gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774
gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219
gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782
gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612
gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666
gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830
gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212
gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893
gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122
gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663
gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539
gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156
gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590
gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394
gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490
gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957
gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398
gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514
gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631
gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945
gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648
gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734
gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587
gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265
gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290
gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151
gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582
gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122
gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879
gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899
gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071
gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905
gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035
gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891
gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995
gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008
gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_119|beg|2677|length|107|forward|gi
Query_DNA-Sequence
caTtctttgtctgcagTttgTaagtaattgtaaccgccatctctTgcacctcttgctctaaattcttttgcttctctttccctttcagtctgcattcttctataaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_120|beg|1135|length|135|forward|gi
Query_DNA-Sequence
ttcaggtgtttTcttctttagtttctttttttttctactttaaaatcctctgaagtttcaagtcTttcctagtttaattttttttgtaatctctcttttatttctccagatttaacatctacagttttaccaact

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_121|beg|2188|length|139|forward|gi
Query_DNA-Sequence
cccttgtgatgcaaaacttattgcaaaaaatataataaataatttttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccTacttcttaattgtgaatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_122|beg|2648|length|136|forward|gi
Query_DNA-Sequence
tttattagcTatttgctaaaattaagaaacatctttgtctgcagttgaagtaattgtaaccgccatctctgcTacctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctataaattgc

Coding-DNA-Entry-Section

Coding-DNA
acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat
Protein-Sequence
MLPLALNSFASLSFQVCILL*I
Hit-Information Section

Coding-DNA
acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat
Protein-Sequence
MLPLALNSFASLSFQVCILL*I
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_124|beg|1867|length|123|forward|gi
Query_DNA-Sequence
agcaccaacaaccgtcTgctttatattctttatcaccatTcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtTgattacaattccactctcttctattataaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_125|beg|399|length|122|forward|gi
Query_DNA-Sequence
aaaagttttttataaaattttttttgtccttTctttttaacattagtctaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatataga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_127|beg|429|length|118|forward|gi
Query_DNA-Sequence
tcttttttagacattagtctaactttattttctaaacttaagaggtatTctctggaaTttttaactagtccattgattaatgattgaaaatataacctgttccaccaactaaaattgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_129|beg|649|length|134|forward|gi
Query_DNA-Sequence
gtttaaatttttttgttcttgcttgttgggtcttgcagttaatattttttaatttttgtaaaacctgcatacttcggcattgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_130|beg|412|length|134|forward|gi
Query_DNA-Sequence
aaattttttttcccttcttttttagacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatTattgaaaatatagacctgttccaccaactaaaattggaa

Coding-DNA-Entry-Section

Coding-DNA
gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt
Protein-Sequence
LINGLVKIPEIPLKFRNKVKTNV*K
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949
gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247
gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590

Coding-DNA
gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt
Protein-Sequence
LINGLVKIPEIPLKFRNKVKTNV*K
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949
gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247
gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_131|beg|1189|length|109|forward|gi
Query_DNA-Sequence
ttcaagtcttcctagtttaatttttttttgtaatctctcttttatttcccagattttaacatctacagttttaccaacttctgttttgtgcaacaattattggtaattc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_134|beg|2655|length|133|forward|gi
Query_DNA-Sequence
gcatttgctaaaaattacagaaacatctttgtctgcattgaagtaattgtaaccgccatctctgcacctcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgcatca

Coding-DNA-Entry-Section

Coding-DNA
tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca
Protein-Sequence
TSCSKILLLLFPFQSAFFYKLH
Hit-Information Section

Coding-DNA
tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca
Protein-Sequence
TSCSKILLLLFPFQSAFFYKLH
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_135|beg|1571|length|125|forward|gi
Query_DNA-Sequence
cccaaaattgctgtgttaattccaattTacatcaccattcatatcaaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga

Coding-DNA-Entry-Section

Coding-DNA
caaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga
Protein-Sequence
SIGLSRYEDYIQTDASINSGNQADLYLI
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038184 to: 1038243
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 2205020 to: 2205067
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777178 to: 777240
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2466995 to: 2467057
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887248 to: 1887292
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367268 to: 1367312
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364418 to: 1364462
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355875 to: 1355919
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349173 to: 1349217
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1177848 to: 1177910
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 446564 to: 446626
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1158669 to: 1158731
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1157008 to: 1157070
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1277786 to: 1277848
gi-nr: gi|2077988 gi_def: C.jejuni htrA gene hsp_num: 1 from: 657 to: 719
gi-nr: gi|881374 gi_def: Campylobacter jejuni heat shock protein/serine protease (htrA) and OmpR protein (ompR) genes, partial cds hsp_num: 1 from: 300 to: 362
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8664 to: 8708
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 821479 to: 821538
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418555 to: 2418599
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617821 to: 2617865
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175321 to: 5175380
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535290 to: 2535349
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455153 to: 2455212
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835722 to: 1835769
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 682 to: 720
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 490 to: 528
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 952 to: 990
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1048 to: 1086
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 962 to: 1000
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1003 to: 1041
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325713 to: 325757
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316824 to: 2316868
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904655 to: 904699
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118083 to: 2118127
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057417 to: 2057461
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395879 to: 1395923
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085596 to: 2085640
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 29111 to: 29155
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563416 to: 1563460
gi-nr: gi|1184674 gi_def: Pseudomonas aeruginosa HtrA-like serine protease AlgW gene, complete cds hsp_num: 1 from: 647 to: 691


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_136|beg|1888|length|113|forward|gi
Query_DNA-Sequence
atattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaataacatgattgttTagtgattacaattccactctcttctattataaatcctgaaccaagtgca

Coding-DNA-Entry-Section

Coding-DNA
tattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaata
Protein-Sequence
ILYHHQLETKNLLHFE*H
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_137|beg|1463|length|117|forward|gi
Query_DNA-Sequence
acacccagccatcctttttagtttcaccaaattctatcaattgatttacaaactctttttcatcgttcgatggtattgaaaaaccTtatcccaatagagccacctttacccaaaatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_139|beg|1739|length|127|forward|gi
Query_DNA-Sequence
aagccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtataaatttttcttttgaatctatttgaagggactgcaatatcagataaagg

Coding-DNA-Entry-Section

Coding-DNA
agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat
Protein-Sequence
FIPVKFGNSDQARIGDWVIAIGQSLWL
Hit-Information Section
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009

Coding-DNA
agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat
Protein-Sequence
FIPVKFGNSDQARIGDWVIAIGQSLWL
Hit-Information Section
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_141|beg|506|length|130|forward|gi
Query_DNA-Sequence
tgattgaaaataTtagacctgttccaccaactaaaattggaatttttttctttttttgaatattttcaattttttttaattgttagttctaaccattgtccagTttgaaatttttcatttaaatcaacTa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_143|beg|976|length|104|forward|gi
Query_DNA-Sequence
ttcaacaataacatctccaacatttaagtaatctattTgggctattttttccaatatttgttataactaaaccgttgtttgattgggtaattttctttgctcaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_144|beg|430|length|123|forward|gi
Query_DNA-Sequence
cttttttagacattagtctaactttatttctaaacttTaagaggtatctctggaattttaactagccattgattaatgattgaaatatagacctgttcccaccaactaaaattggaatttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_146|beg|2552|length|129|forward|gi
Query_DNA-Sequence
tcTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacccttcatgatttcagattctttattagcatttgctaaaattacagaaaca

Coding-DNA-Entry-Section

Coding-DNA
cTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacc
Protein-Sequence
RVKVNGERNKIFAEAFGRDAEFFAFYK
Hit-Information Section
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417151 to: 2417219
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610391 to: 3610459
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2119180 to: 2119254
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086693 to: 2086767


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_147|beg|2563|length|138|forward|gi
Query_DNA-Sequence
caaaaaattctgcTatctcttccaaaggctttctgcTaaagatcttatttctttcaccatcaccttgacccttTcatgatttcagattctttattagcatttgctaaattacagaaacaTtctttgtcTtgcagttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_148|beg|1090|length|134|forward|gi
Query_DNA-Sequence
attcaatgtcttacaattatttttaaagatttaatttcagaaatttcaggtgTtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgaatctc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_150|beg|845|length|140|forward|gi
Query_DNA-Sequence
ttaacaccaatatatcttctttggtttttgattattgtaaattacaatcaaaatagttttttgatttagattttaaaacagttgcctacaatatcttcaagatctttagtagattttattttttttcttttTgagcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_151|beg|2095|length|113|forward|gi
Query_DNA-Sequence
tgtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtcttttgcaaacccttgtgatgcaaaact

Coding-DNA-Entry-Section

Coding-DNA
gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt
Protein-Sequence
QKNAPASFADLAEKLMPSVVNISTNDNSYY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544

Coding-DNA
gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt
Protein-Sequence
QKNAPASFADLAEKLMPSVVNISTNDNSYY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_157|beg|812|length|143|forward|gi
Query_DNA-Sequence
aattttggactgcttgtccattattaaTtctagcttaacaccaaatatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgaTttagattttaaaacagtgccctacaataTtcttcaagatcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_159|beg|2326|length|121|forward|gi
Query_DNA-Sequence
ttatcatctccattttttaacatacttttcatttttgatggaaataaggcatataaattcctttataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_160|beg|726|length|130|forward|gi
Query_DNA-Sequence
gcattgatgatttctccttcaattttttttgcaatcttTaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagctaacaTccaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_161|beg|2351|length|103|forward|gi
Query_DNA-Sequence
acttttcatttttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattgctctttcattattttTagattaattttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_168|beg|456|length|131|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatatagacTtgttccaccaactaaaattggaatttttttTctttttttgaatattttcaatttttttaattg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_171|beg|2344|length|139|forward|gi
Query_DNA-Sequence
ttaacatacttttcattttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaatttttaggttttatgttaccaaaaaaatttaaagaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_172|beg|2130|length|115|forward|gi
Query_DNA-Sequence
cagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaataattttttaattctgt

Coding-DNA-Entry-Section

Coding-DNA
agatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaa
Protein-Sequence
DGINFSARSANEAGASFANPCDAKLIAKNIIK
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6132 to: 6233


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_173|beg|2099|length|109|forward|gi
Query_DNA-Sequence
gtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaactt

Coding-DNA-Entry-Section

Coding-DNA
taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVKHFYNDNSY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153

Coding-DNA
taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVKHFYNDNSY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_174|beg|118|length|118|forward|gi
Query_DNA-Sequence
cactctgatcttttttaatttttagtttaagaaattttttaacttcTagaaatggctccattattttagcatgctagaaTttcttaaattaatttttcaacaacttttctctttttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_176|beg|703|length|109|forward|gi
Query_DNA-Sequence
ttttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat

Coding-DNA-Entry-Section

Coding-DNA
tttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat
Protein-Sequence
ILISGPTASGKSNFALRLQKKLKGEIINADSMQVYK
Hit-Information Section
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2665684 to: 2665791
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 447944 to: 448048
gi-nr: gi|145361991 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454
gi-nr: gi|145358247 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454
gi-nr: gi|14532863 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 157 to: 264
gi-nr: gi|13430591 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 272 to: 379
gi-nr: gi|21404588 gi_def: Arabidopsis thaliana clone 19250 mRNA, complete sequence hsp_num: 1 from: 347 to: 454
gi-nr: gi|14279069 gi_def: Arabidopsis thaliana AtIPT9 mRNA for tRNA isopentenyltransferase, complete cds hsp_num: 1 from: 157 to: 264
gi-nr: gi|147865869 gi_def: Vitis vinifera contig VV78X183130.5, whole genome shotgun sequence hsp_num: 1 from: 17496 to: 17597


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_178|beg|798|length|120|forward|gi
Query_DNA-Sequence
cctgTaaattaagataattttggactgcttgtccattattaatctagcttaacTaccaatatatcttctttggTtttttgattattgtaaattacaatcaaaatagttttttgatagatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_180|beg|1876|length|142|forward|gi
Query_DNA-Sequence
aaccgtcgctttatattctttatcaccTatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcaTgcagacttccttgtt

Coding-DNA-Entry-Section

Coding-DNA
Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca
Protein-Sequence
MEIVITNNHVIQNAEDILVRVDR
Hit-Information Section
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510
gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586

Coding-DNA
Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca
Protein-Sequence
MEIVITNNHVIQNAEDILVRVDR
Hit-Information Section
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510
gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_184|beg|2553|length|112|forward|gi
Query_DNA-Sequence
ctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcaccatcaccttgacccttcatgatttcagattctttaTttagcatttgc

Coding-DNA-Entry-Section

Coding-DNA
tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca
Protein-Sequence
CRKQKILHLFQRLLQMILFLSP
Hit-Information Section
gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317
gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216
gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555
gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692
gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175
gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353
gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857
gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104

Coding-DNA
tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca
Protein-Sequence
CRKQKILHLFQRLLQMILFLSP
Hit-Information Section
gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317
gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216
gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555
gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692
gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175
gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353
gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857
gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_186|beg|1013|length|109|forward|gi
Query_DNA-Sequence
gggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaaagatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_187|beg|162|length|137|forward|gi
Query_DNA-Sequence
tcagaaaTtggctccattatttagcatgctagaagttcttaaattaatttttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_188|beg|62|length|104|forward|gi
Query_DNA-Sequence
ggtaatttcatcatttagatactgtgtcaattcggcaatcccaattaccTttTgtttacactctgatcttttttaatttttagtttTaagaaattttttaactt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_191|beg|1166|length|133|forward|gi
Query_DNA-Sequence
tctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaatctctcttttatttctccagattttaacatctacagtttttaccaacttctgtttgtgcaacaattattggtaattct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_192|beg|2154|length|139|forward|gi
Query_DNA-Sequence
gatccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattgcaaaaaatataataaataattttttaaattctgttctttaactttttatataccaaataattataaaacctataactgca

Coding-DNA-Entry-Section

Coding-DNA
atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg
Protein-Sequence
CNKFCITKGFAKRRTTSFAD
Hit-Information Section
gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703
gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660

Coding-DNA
atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg
Protein-Sequence
CNKFCITKGFAKRRTTSFAD
Hit-Information Section
gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703
gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_193|beg|2191|length|126|forward|gi
Query_DNA-Sequence
ttgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaTtaactgTcaaaaattaacccaccacttcttaatt

Coding-DNA-Entry-Section

Coding-DNA
tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT
Protein-Sequence
VMQNLIAKNIINNFLIRHFNFLLPNNYKTY
Hit-Information Section
gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081

Coding-DNA
tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT
Protein-Sequence
VMQNLIAKNIINNFLIRHFNFLLPNNYKTY
Hit-Information Section
gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_196|beg|644|length|129|forward|gi
Query_DNA-Sequence
atgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacaca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_197|beg|1777|length|140|forward|gi
Query_DNA-Sequence
aattcttgcTttgatcagaatttccaaatttaaTctggtataaatttttcttttgaatTctatttgaaggactgcaatatcaataagggatcTagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_198|beg|2133|length|132|forward|gi
Query_DNA-Sequence
atggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaacttttttatata

Coding-DNA-Entry-Section

Coding-DNA
tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt
Protein-Sequence
AKDAPASFADLAEKLMP
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166

Coding-DNA
tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt
Protein-Sequence
AKDAPASFADLAEKLMP
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_201|beg|1222|length|105|forward|gi
Query_DNA-Sequence
ctctcttttatttctccagaTttttaacaTtctaTcagttttaccaacttctgtttgtgcTaacaattTattggtaattctttcatctctttaatcttagtgtta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_206|beg|1287|length|116|forward|gi
Query_DNA-Sequence
ttggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaacactagcaactaatgctc

Coding-DNA-Entry-Section

Coding-DNA
tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa
Protein-Sequence
CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP
Hit-Information Section
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279

Coding-DNA
tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa
Protein-Sequence
CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP
Hit-Information Section
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_207|beg|706|length|102|forward|gi
Query_DNA-Sequence
tgtaaacctgcatactgtcggcttgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttacctgtgcagtcggtcctgaaattaag

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_208|beg|2200|length|128|forward|gi
Query_DNA-Sequence
aaaacttattgcaaaaaatataataaataattttttaattctgttcattttTaacttttttatataccaaataattataaaacctataactgcaaaaattaacccacccacttcttaattgtgaatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_211|beg|947|length|105|forward|gi
Query_DNA-Sequence
ttagtagattttattttttttcttttgagcttTcaacaataacatctccaacatttaagtaatctattgggctattttttccaatatttgttaTtaactaaacct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_213|beg|491|length|131|forward|gi
Query_DNA-Sequence
tagtccattgattaatgattgaaaatatagacctgttccaccaactaaaattggaatttttttttctttttttgaaattattttcaatttttttaattgttagttctaaccattgtccagttgaaaatttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_214|beg|1317|length|108|forward|gi
Query_DNA-Sequence
tgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgcaactaatctcctctaggtcatctaatttttc

Coding-DNA-Entry-Section

Coding-DNA
gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc
Protein-Sequence
LHSVAENSPSDKAGIKAGDIILEFNN
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528

Coding-DNA
gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc
Protein-Sequence
LHSVAENSPSDKAGIKAGDIILEFNN
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_215|beg|889|length|99|forward|gi
Query_DNA-Sequence
aatcaaaatagtttttgattagatttttaaaacagtgcctacaatatcttcaaatctttagtagattttatttttttctttgagcttcaacaataacat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_216|beg|369|length|118|forward|gi
Query_DNA-Sequence
aatttgtcttttgaTttttaggatcaagttttaaaagttttttataaaattttttttgtccttctttttttagacattaTgtctaactttatttctaaacttaagaggtatctctgga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_217|beg|1018|length|100|forward|gi
Query_DNA-Sequence
attttttccaatatttgttTataactaaacctgttgtttgattgggtaattttttgctcaatatcttcatcattcaatgggtcttacaattatttttaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_218|beg|2103|length|133|forward|gi
Query_DNA-Sequence
tgttgtcgttgtagaaatgttacaacagatggTcattaattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaataatttttt

Coding-DNA-Entry-Section

Coding-DNA
taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata
Protein-Sequence
IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN**
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233
gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525

Coding-DNA
taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata
Protein-Sequence
IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN**
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233
gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_220|beg|938|length|111|forward|gi
Query_DNA-Sequence
tcaagatctttagtagattttatttttttcttttggcttcaacaataacatctccaacatttaaagtaattctattgggctattttttccaatattgttataactaaaccc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_224|beg|149|length|112|forward|gi
Query_DNA-Sequence
aaattttttaacttcagaaaTtggctccattatttagcatgctagaagttcttaaattaattttttcaacaagTcttttctctttttgtTatcaatatggtagttttTaaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_229|beg|1420|length|141|forward|gi
Query_DNA-Sequence
tttttcaacttcacaatttcttcagaaacttacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaacctatcccaatag

Coding-DNA-Entry-Section

Coding-DNA
aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa
Protein-Sequence
VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920

Coding-DNA
aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa
Protein-Sequence
VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_232|beg|456|length|110|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaaatttttaactagtccattgattaatgattgaaaatatTagacctgttccaccaactaaaattggaattttttttcttttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_233|beg|1242|length|113|forward|gi
Query_DNA-Sequence
ttttaacatctacaTgttttaccaacttctgtttgtgcaacaattattggtaattctttcatctTctttaatcttagtgtttattaaactctaatataatgtctcctgcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_234|beg|2186|length|109|forward|gi
Query_DNA-Sequence
aacccttgtgatgcaaaacttattgcaaaaaataTtaataaatTaattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_235|beg|1926|length|133|forward|gi
Query_DNA-Sequence
ctgcattttgaataacttgattgttagtgattacaattccactctcttctattataaatccTtgTaaccaagtgcagcagaTcttccttgtttgaggtgttccaaattctttTgaacatatcttcaaaaggtg

Coding-DNA-Entry-Section

Coding-DNA
tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat
Protein-Sequence
GFIIEESGIVITNNQVIQNA
Hit-Information Section
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370

Coding-DNA
tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat
Protein-Sequence
GFIIEESGIVITNNQVIQNA
Hit-Information Section
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_236|beg|39|length|140|forward|gi
Query_DNA-Sequence
attaactcttctgcttcatccaaggtaatttcatcatttagatactgtgtcaattcggcaatcccaatttaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatggctccat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_238|beg|298|length|131|forward|gi
Query_DNA-Sequence
catacatagatatattgtataagatttaatctcataagctcttatggatctttgagtTatcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_239|beg|1785|length|104|forward|gi
Query_DNA-Sequence
cttgatcagaatttccaaaatttaactggtataaatttttcttttgaatctatttgaaggactgcaatatagataagggatcagcaTccaacaaccgtcgcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_240|beg|2650|length|122|forward|gi
Query_DNA-Sequence
tattagcatttgctaaaattacagaaacTatctttgtctgcagttgaagtaattgtaaccgccatctctgcacctttgctctaaattcttttgcTttctctttccctttcagtctgcattct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_242|beg|2685|length|110|forward|gi
Query_DNA-Sequence
tctgcagttgaagtaattgtaaccgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcctgcattcttctataaattgcatcTactgTtttg

Coding-DNA-Entry-Section

Coding-DNA
accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc
Protein-Sequence
NRHLCTSCLNSLLLFPFQS
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728
gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836
gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331

Coding-DNA
accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc
Protein-Sequence
NRHLCTSCLNSLLLFPFQS
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728
gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836
gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_243|beg|2274|length|118|forward|gi
Query_DNA-Sequence
aTtaaaacctataactgcaaaaattaacccaccacttcttaattgtgaatcttttatcatctccatttttttaacatacttttcattttgatggaaataaggcatataaaattccttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_244|beg|2261|length|100|forward|gi
Query_DNA-Sequence
ataccaaaTtaattataaaacctataacTtgcaaaattaacccaccacttTcttaattgtgaatcttttatcatctccattttttaacatacttttcatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_245|beg|865|length|117|forward|gi
Query_DNA-Sequence
ttggttttgattatttgtaaattTacaatcaaaatagttttttgattagattttaaaacagtgcctacaatatcttcaagatctttagtagattttatttttttcttttgagcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_247|beg|40|length|122|forward|gi
Query_DNA-Sequence
ttaactcttctgcttcatccaaggtaatttcaTtcatttagatactgtTtcaattcggcaatcccaattaccttgtttacactctgatTctttttttaatttttaTgtttaagaaattttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_248|beg|2769|length|131|forward|gi
Query_DNA-Sequence
cttctataaattgcatcactgttttgcttgtggaaggtccgctcttttaatttctaacatctTactattttaattccaaaactttcagcttcagtatttacaccttcttgTtattaaagccatttgtttag

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def rreeaadd_249|beg|2033|length|131|forward|gi
Query_DNA-Sequence
ttgaacatacttTcaaaaggtgatcctgggggaaactgaaaaccaggaaatggattagaatttgtagtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccTagatccgca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_001|beg|888|length|144|forward|gi
Query_DNA-Sequence
caaataatgggaTggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggTacagattcttgcatagctc

Coding-DNA-Entry-Section

Coding-DNA
tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggT
Protein-Sequence
GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWVWY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613
gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340

Coding-DNA
tgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtccctttatacagtctttaaccctaacgttcctccttggtgggtttggT
Protein-Sequence
GEHLFAASIIIGKISSVITLMSLYTVFNPNVPPWWVWY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186949 to: 187014
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7545 to: 7613
gi-nr: gi|109121340 gi_def: PREDICTED: Macaca mulatta hypothetical protein LOC711856 (LOC711856), mRNA hsp_num: 1 from: 323 to: 340


Query-DNA-Entry-Section

Query-DNA-Def dare_002|beg|758|length|128|forward|gi
Query_DNA-Sequence
ttagcccttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTttgatcTtcattgggtt

Coding-DNA-Entry-Section

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912

Coding-DNA
ttatctttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatatccaaatccgaggtggtaccagaTtattcTt
Protein-Sequence
PLSFSQFGGKYQVEFPLSSRLGFAVYPNPRWYQIIL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172764 to: 172868
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7419 to: 7508
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186814 to: 186912


Query-DNA-Entry-Section

Query-DNA-Def dare_004|beg|641|length|108|forward|gi
Query_DNA-Sequence
ttgttacctctctttaggagcattccttcttccctccaggtataacctccttaaataatacgtTcaatggatttctgatgtatttacagtgcttatcggagtgcacaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_006|beg|1414|length|104|forward|gi
Query_DNA-Sequence
gtaaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttag

Coding-DNA-Entry-Section

Coding-DNA
taaactctttcaattttcctttacatcctctgttggTaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttt
Protein-Sequence
KLFQFSFTSSVGKFYGGAHINAYLLRLDLLF
Hit-Information Section
gi-nr: gi|90819360 gi_def: Mus musculus BAC clone RP23-136O24 from chromosome 12, complete sequence hsp_num: 1 from: 123377 to: 123436


Query-DNA-Entry-Section

Query-DNA-Def dare_008|beg|644|length|131|forward|gi
Query_DNA-Sequence
ttaccctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtTatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_010|beg|533|length|125|forward|gi
Query_DNA-Sequence
ctccccgaatgatcgaatccaaattcccttaactctaatgtcttcacaatgaatctggtaTtgtccttaaccttccattcattggtgtaaaagttcTtttctttcctctcttgtttacctcTtct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_011|beg|1241|length|142|forward|gi
Query_DNA-Sequence
agcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagatTcttccctcttgaggtacacacgcccttcgtatatgtaatagttcgctaacttttcatcgggaactagatctaTggaagtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_012|beg|1105|length|116|forward|gi
Query_DNA-Sequence
agggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctg

Coding-DNA-Entry-Section

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170

Coding-DNA
gggggaaagaaTctccTggccttagttttcctccttgaatctctccgaattttcttccaaactcTtt
Protein-Sequence
RKEFGRKFGEIQGGKLRPGDSFP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173167 to: 173217
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173120 to: 173170


Query-DNA-Entry-Section

Query-DNA-Def dare_014|beg|116|length|113|forward|gi
Query_DNA-Sequence
cTaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaacccctt

Coding-DNA-Entry-Section

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271

Coding-DNA
TaacaTtcctcgattttcactaTgcagaaacaaatgacaaaattcttttcccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccc
Protein-Sequence
RGYHIRVLDEWALKLDSKSRGKEFCHLFLHSENRGML
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6799 to: 6858
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599823 to: 1599882
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 442 to: 501
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186212 to: 186271


Query-DNA-Entry-Section

Query-DNA-Def dare_017|beg|1014|length|130|forward|gi
Query_DNA-Sequence
ttTcttgcatagctcaaaaagctcgtTcaataatacggtaattgcatagttccaattccctgaggaacaccctttagggcgttcttaatacaagggggaagaactccggccttagttttcctccttgaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_019|beg|1097|length|125|forward|gi
Query_DNA-Sequence
ttaatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaactcttcctccgcaaaggcttggatttcTacccagaactttcctgtagaattcTtg

Coding-DNA-Entry-Section

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144

Coding-DNA
taatacaagggggaaagaactccggccttagttttcctccttgTaatctctTccgaattttcttccaaact
Protein-Sequence
LIQGGKNSGLSFPPCNLFRIFFQT
Hit-Information Section
gi-nr: gi|18464295 gi_def: Homo sapiens BAC clone RP11-287D1 from 2, complete sequence hsp_num: 2 from: 92115 to: 92144


Query-DNA-Entry-Section

Query-DNA-Def dare_020|beg|737|length|114|forward|gi
Query_DNA-Sequence
ggagtgccacaattgtggggcTgttagcccttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtttgctgtatatccaaatcc

Coding-DNA-Entry-Section

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398

Coding-DNA
ttatcttttcacagtttgggggaaagtaccaggtggaatttccgctgtcttcgaTggctaggaTtt
Protein-Sequence
PLSFHSLGESTRWNFRCLRWLGF
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 2 from: 172753 to: 172818
gi-nr: gi|125811611 gi_def: Drosophila pseudoobscura GA17709-PA (Dpse\GA17709) mRNA, partial cds hsp_num: 1 from: 3061 to: 3096
gi-nr: gi|24580353 gi_def: Homo sapiens chromosome 5 clone CTB-174D11, complete sequence hsp_num: 2 from: 151360 to: 151398


Query-DNA-Entry-Section

Query-DNA-Def dare_023|beg|307|length|113|forward|gi
Query_DNA-Sequence
tttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg

Coding-DNA-Entry-Section

Coding-DNA
ttaagcaaattggacaTtactgttcctggctcatgtcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctg
Protein-Sequence
FKQIGHYCSWLMSHLLNGKSLASMSKTSSVPNHPSIS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186396 to: 186467
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599621 to: 1599686
gi-nr: gi|19774528 gi_def: Homo sapiens chromosome 1 clone RP4-672J20, complete sequence hsp_num: 2 from: 3022 to: 3051


Query-DNA-Entry-Section

Query-DNA-Def dare_024|beg|1651|length|104|forward|gi
Query_DNA-Sequence
tatcagtttctcTattttttactacccctaatcctttctatcacatcgtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_026|beg|1|length|117|forward|gi
Query_DNA-Sequence
tTggggaagcttaatcctcagtataaaatagccaaatctgaggcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagtttctgaactcttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_027|beg|980|length|135|forward|gi
Query_DNA-Sequence
accctaacgttcctccttggtgggtttggacagattcttgcatagctcaaaagctccgtcaataatacggtaaTttgcatagttcctaattccctgaggaacaccctttaagggcgttcttaatacaagggggaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_029|beg|787|length|99|forward|gi
Query_DNA-Sequence
aaaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttgatcct

Coding-DNA-Entry-Section

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230

Coding-DNA
aaagtaccaggtggaatttccgctgtcttcgggcaggatttgctgtaatccaaatccgaggtggtaccagatattcttgatctcattgggttga
Protein-Sequence
DQPNEIKNIWYHLGFGLQQILPEDSGNSTWYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186888 to: 186935
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186837 to: 186866
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7484 to: 7531
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7433 to: 7462
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599132 to: 1599182
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599201 to: 1599230


Query-DNA-Entry-Section

Query-DNA-Def dare_030|beg|369|length|133|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatggtaatcttcgaagatccctaattc

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcatagggggccgtggccctta
Protein-Sequence
HLCQRRVQSLTIPPFPGASHKVQRWNKRHRGPWPL
Hit-Information Section
gi-nr: gi|156087686 gi_def: Babesia bovis variant erythrocyte surface antigen-1, beta subunit (BBOV_III001150) mRNA, complete cds hsp_num: 1 from: 1488 to: 1520
gi-nr: gi|134060311 gi_def: Leishmania braziliensis chromosome 14 hsp_num: 1 from: 507261 to: 507302


Query-DNA-Entry-Section

Query-DNA-Def dare_031|beg|1449|length|127|forward|gi
Query_DNA-Sequence
gTaaattctatggcggtgctcacatcaatgcttatctcctccggcTttgaTtctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttcttataccat

Coding-DNA-Entry-Section

Coding-DNA
ttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcg
Protein-Sequence
LELVKKANLIIYSERLKRK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187545 to: 187610


Query-DNA-Entry-Section

Query-DNA-Def dare_032|beg|1594|length|105|forward|gi
Query_DNA-Sequence
caatagggcatagaattgagctagatccattacgttatcttgatctaaaaacttgtTctatcagtttctcatttttttactaccctaatcctttctatcacatcg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_034|beg|1680|length|114|forward|gi
Query_DNA-Sequence
tcctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactTaaatgggtcga

Coding-DNA-Entry-Section

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426

Coding-DNA
cctttctTatcacatcgTtcaacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcactT
Protein-Sequence
PFLSHRSTLTIFGIASIKSLIDPNPFSSSLAFSL
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 1 from: 173697 to: 173780
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 8361 to: 8426


Query-DNA-Entry-Section

Query-DNA-Def dare_035|beg|403|length|141|forward|gi
Query_DNA-Sequence
catcccTtccattttcctggggTcttctcataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga

Coding-DNA-Entry-Section

Coding-DNA
ttcgagatcccTtaatgtcagtatattggtttttcctgtcactaggcccctctcccga
Protein-Sequence
SSRSLNVSILVFPVTRPLSR
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 8 from: 172424 to: 172495
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 168 to: 239
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7061 to: 7132
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 3 from: 1599543 to: 1599614
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186474 to: 186566
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 188 to: 253


Query-DNA-Entry-Section

Query-DNA-Def dare_036|beg|927|length|103|forward|gi
Query_DNA-Sequence
ttatcggtaaaatttctcagttattactctaatgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa

Coding-DNA-Entry-Section

Coding-DNA
atgTtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattcttgcatagctcaa
Protein-Sequence
LSYARICPNPPRRNVRVKDCIKEH*S
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7574 to: 7675
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187011 to: 187079
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1598988 to: 1599056


Query-DNA-Entry-Section

Query-DNA-Def dare_039|beg|348|length|135|forward|gi
Query_DNA-Sequence
ccttcttaacggtaagtccttagcatctatgtcaaaaacgagttcagTtccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggcccttatgtaatc

Coding-DNA-Entry-Section

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284

Coding-DNA
ccctaaccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacggcataggggccgtggccc
Protein-Sequence
KGHGPYAVYSSVALYEKPQEMEGWLGN
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 2 from: 1599577 to: 1599642
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 4 from: 186446 to: 186523
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 4 from: 7033 to: 7098
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 4 from: 202 to: 267
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 207 to: 284


Query-DNA-Entry-Section

Query-DNA-Def dare_040|beg|1698|length|122|forward|gi
Query_DNA-Sequence
caacgctaactattttggaattgcgtccataaaatcattaattgaccccgaatccttttagtagttctttagctttttcactaaatggtcagcatgatcatcactaaagctatcaagataaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_044|beg|1656|length|107|forward|gi
Query_DNA-Sequence
gtttctcatttttttactaccctaatcctttatcacatcgtcaaTcgctaactatttttggaattgcgtccaaaatcattaattgacccgaatccttttagtagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_045|beg|1544|length|108|forward|gi
Query_DNA-Sequence
tttttcacaagttcgaTgttctataccatagggtgagtaggatagggcccccaatagggcaTtagaattgagctagatccattacgttatcttgatctaaaacttgtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_046|beg|21|length|137|forward|gi
Query_DNA-Sequence
taaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattc

Coding-DNA-Entry-Section

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639

Coding-DNA
aaaaatagccaaatctgagcctaaaagcccttggatatccatgatttagaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaa
Protein-Sequence
FLSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186074 to: 186202
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6661 to: 6789
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 511 to: 639


Query-DNA-Entry-Section

Query-DNA-Def dare_048|beg|1471|length|136|forward|gi
Query_DNA-Sequence
atcaatgcttatctcctTccggcttgatTctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagttcgagttctataccatTaggggtgagtaggatTagggcccccaataggg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_050|beg|1088|length|119|forward|gi
Query_DNA-Sequence
aggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccgaattttcttccaaactcttcctccTgcaaaggcttggatttcacccagaactttcc

Coding-DNA-Entry-Section

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202

Coding-DNA
ggggttcttaatacaagggggaaagaactccggccttagttttccTtccttgaatcttcccga
Protein-Sequence
MEENSGRFKEGKLRPEFFPPCIKNP
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187143 to: 187202


Query-DNA-Entry-Section

Query-DNA-Def dare_053|beg|875|length|143|forward|gi
Query_DNA-Sequence
ttgggttgatcctcaaataatggaggtTgagcatctatttgcggcTttcaaTttattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagat

Coding-DNA-Entry-Section

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064

Coding-DNA
tattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacag
Protein-Sequence
ICPNPPRRNVRVKDCIKDIRVITEEILPIIN
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7571 to: 7660
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186975 to: 187064


Query-DNA-Entry-Section

Query-DNA-Def dare_055|beg|880|length|139|forward|gi
Query_DNA-Sequence
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagattctt

Coding-DNA-Entry-Section

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137

Coding-DNA
ttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaatgtcctttatacagtctttaaccctaacgttcctccttggtgggtttggacagatt
Protein-Sequence
RICPNPPRRNVRVKDCIKDIRVITEEILPIIIEAANRCSPPLFEDQ
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186930 to: 187067
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7526 to: 7663
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599000 to: 1599137


Query-DNA-Entry-Section

Query-DNA-Def dare_057|beg|596|length|139|forward|gi
Query_DNA-Sequence
ccTttaaccttccattcattggtgtTaaaattctttctttcctctcttgttacctctcttTaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgctt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_060|beg|428|length|133|forward|gi
Query_DNA-Sequence
cataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattccct

Coding-DNA-Entry-Section

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251

Coding-DNA
ataaagtgcaacgctggaataaacggcatagggggccgtggcccttatgtaatcttcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcc
Protein-Sequence
REFGFDHSGEGPSDRKNQYTDIRDLEDYIRATAPYAVYSSVALY
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7066 to: 7197
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 103 to: 234
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186479 to: 186610
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599478 to: 1599609
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 120 to: 251


Query-DNA-Entry-Section

Query-DNA-Def dare_061|beg|941|length|104|forward|gi
Query_DNA-Sequence
tcctcagttattactctaatgtcctttatacagtctttaacccTtaacgttTcctccttggtgggttggacagattcttgcatagTctcaaaaaagTctcgtca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_067|beg|463|length|139|forward|gi
Query_DNA-Sequence
gccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaatgtcttcacaaatgaaatctggtatgtcctt

Coding-DNA-Entry-Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
RWPLCNSSRSLMSVYWFFLSQAPLPNDRIQIPLTLM
Hit-Information Section

Coding-DNA
ccgTtggcccttatgtaatTcttcgagatccctaatgtcagtatattggtttttcctgtcacaggcccctctcccgaatgatcgaatccaaattcccttaactctaa
Protein-Sequence
TLELREFGFDHSGEGPVTGKTNILTLGISKNYIRANG
Hit-Information Section
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 524239 to: 524283


Query-DNA-Entry-Section

Query-DNA-Def dare_068|beg|832|length|108|forward|gi
Query_DNA-Sequence
tgtatatccaaatccgaggtggTtaccagatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatcggtTaaa

Coding-DNA-Entry-Section

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161

Coding-DNA
gatattcttgatctcattgggttgatcctcaaataatggaggtgagcatctatttgcggcttcaattattatc
Protein-Sequence
PIIIEAANRCSPPLFEDQPNEIKNIW
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7502 to: 7579
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186906 to: 186983
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599084 to: 1599161


Query-DNA-Entry-Section

Query-DNA-Def dare_069|beg|1530|length|127|forward|gi
Query_DNA-Sequence
taattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggcccccaattagggcatagaattgagctagatccattacgttatctgatctaaaaacttgtctatca

Coding-DNA-Entry-Section

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595

Coding-DNA
agttcgcctttttcacaagttcgagttctataccatagggtgagtaggaTtagggccccc
Protein-Sequence
LSSPFSQVRVLYHRVSRIRAP
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 4 from: 173530 to: 173595


Query-DNA-Entry-Section

Query-DNA-Def dare_071|beg|1193|length|126|forward|gi
Query_DNA-Sequence
cccagaactttcctgtagaattctgggTagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttgctccatatccttattagaTtcttcccTtcttgagg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_074|beg|1168|length|132|forward|gi
Query_DNA-Sequence
ttcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggcttttTgctccatatcct

Coding-DNA-Entry-Section

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927

Coding-DNA
tcctccgcaaaggcttggatttTcacccagaacTtttcctgtagTaattctgggagttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcTaaaggc
Protein-Sequence
KPLERNVERGVNMLYEIRDELPELLQEKFWVKIQAFAEE
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7859 to: 7927


Query-DNA-Entry-Section

Query-DNA-Def dare_075|beg|616|length|127|forward|gi
Query_DNA-Sequence
gtgtaaagttctttcTtttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_076|beg|257|length|108|forward|gi
Query_DNA-Sequence
actcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaaTg

Coding-DNA-Entry-Section

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341

Coding-DNA
ctcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgttcctggctcatgctcgcaccttcttaacggtaa
Protein-Sequence
LPLRRCEHEPGTVCPICLNDAKEIVRDTVIILREE
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186308 to: 186412
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6895 to: 6999
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 301 to: 405
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 2 from: 318 to: 341


Query-DNA-Entry-Section

Query-DNA-Def dare_077|beg|136|length|118|forward|gi
Query_DNA-Sequence
gcagaaacaaaTtgacaaattctttccctggacttcgaatcTtagcttgagggcccattctccaaaactctaatatggtaaccccttccagaatatatgatatgtatgtcattgaatc

Coding-DNA-Entry-Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section

Coding-DNA
caaaactctaatatggtaaccccttccagaatatatgatatgtatgtca
Protein-Sequence
LQNSNMVTPSRIYDMYVI
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_079|beg|399|length|135|forward|gi
Query_DNA-Sequence
taaccatTcccccatttcctggggTcttctcataaagtgTcaacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatccctaatgtcagtataTttggtttttcctgtcTactaggc

Coding-DNA-Entry-Section

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961

Coding-DNA
aacgctggaataaacggcataggggTccgtggcccttatgtTaatcttcgagatcccta
Protein-Sequence
VNAGINGIGVRGPYVNLRDP*C
Hit-Information Section
gi-nr: gi|75812984 gi_def: Mus musculus 10 BAC RP23-425N2 (Roswell Park Cancer Institute (C57BL/6J Female) Mouse BAC Library) complete sequence hsp_num: 1 from: 57405 to: 57452
gi-nr: gi|34419702 gi_def: Mus musculus chromosome 10, clone RP24-77I13, complete sequence hsp_num: 1 from: 153914 to: 153961


Query-DNA-Entry-Section

Query-DNA-Def dare_080|beg|172|length|104|forward|gi
Query_DNA-Sequence
gaatctagcttgagggcccTattatccaaaactctaatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtatta

Coding-DNA-Entry-Section

Coding-DNA
aatatgggtaaccccttccagaatatatgatatgtatgtcattgaatcctaactcctcccttagtat
Protein-Sequence
ILREELGFNDIHIIYSGRGYPY*S
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 391 to: 450
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6850 to: 6909
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186263 to: 186322
gi-nr: gi|6626257 gi_def: Methanothermobacter thermautotrophicus str. Delta H, complete genome hsp_num: 1 from: 523933 to: 523989


Query-DNA-Entry-Section

Query-DNA-Def dare_084|beg|1347|length|139|forward|gi
Query_DNA-Sequence
ctaacttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctTatggcggtgctcacatcaatgcttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_085|beg|335|length|106|forward|gi
Query_DNA-Sequence
gctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagtgcaa

Coding-DNA-Entry-Section

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341

Coding-DNA
ctTcatgctcgcaccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtccctaaaccatccctccatttcctgggcttctcataaagt
Protein-Sequence
ALYEKPRKWRDGLGTELVFDIDAKDLPLRRCEHE
Hit-Information Section
gi-nr: gi|3342818 gi_def: Thermophilic archaeon 'Bonch-Osmolovskaya' primase small subunit homolog gene, complete cds hsp_num: 1 from: 243 to: 341


Query-DNA-Entry-Section

Query-DNA-Def dare_086|beg|1748|length|127|forward|gi
Query_DNA-Sequence
aatccttttTagtagttctttagcttttcactaaatgggtcgagcatgatcatcactaaagctatcaagataaaatgttaacggaggtgtgcaaaatgggcacaaataaagctttttttaccaatga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_088|beg|1859|length|137|forward|gi
Query_DNA-Sequence
cTtttttttacaatgaagttccagaagataatatattgccgcagagaagatatcctcactaaagaagcctgcaactgtcatggataataggtgatgttgacactggaaagacgacgttgacgaTtTataccttgcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_089|beg|41|length|136|forward|gi
Query_DNA-Sequence
gcctaaaagTcccttgggatatccatgatttaTgaacgaaccatcccctcttattcaggagaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgaTcaaaaattctttccctggacttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_093|beg|1523|length|115|forward|gi
Query_DNA-Sequence
gaataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatcttgat

Coding-DNA-Entry-Section

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679

Coding-DNA
aataaataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgtta
Protein-Sequence
DNVMDLAQFYALLGALSYSPYGIELELVKKANLIIY
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187572 to: 187679


Query-DNA-Entry-Section

Query-DNA-Def dare_094|beg|1505|length|137|forward|gi
Query_DNA-Sequence
tttctttttagtctctctgaataataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataTgggcatagaattgagctagatccattacgttatcttgatctaa

Coding-DNA-Entry-Section

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242

Coding-DNA
aataattaagttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaataT
Protein-Sequence
MPILGALSYSPYGIELELVKKANLIII
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187575 to: 187646
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8174 to: 8242


Query-DNA-Entry-Section

Query-DNA-Def dare_096|beg|1310|length|123|forward|gi
Query_DNA-Sequence
ttgaggtacacTacgcccttcgtatatgtaatagttTcgctaaTcttttcatcgggaactagatctaggaagtcagagatcttcattgtgtactctggaattttaccgtaaactctttcaatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_098|beg|863|length|112|forward|gi
Query_DNA-Sequence
ttcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaattaTttatcggtaaaatttcctcagttTattactctaatgtcctttata

Coding-DNA-Entry-Section

Coding-DNA
tcttgatctcattgggtttgatcctcTaaataatggaggtgagcatctatttgcggcttcaatt
Protein-Sequence
IIEAANRCSPPLFRGSNPMRSR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186939 to: 186977


Query-DNA-Entry-Section

Query-DNA-Def dare_100|beg|1440|length|113|forward|gi
Query_DNA-Sequence
cctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgccttttttcac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_101|beg|1647|length|122|forward|gi
Query_DNA-Sequence
tgtctatcagtttctcattttttactaccctaatcctttctatcacatcgtcaacgctaactatttttggaattggtccataaaatcattaattgacccgaatccttttagttagttcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_102|beg|1434|length|133|forward|gi
Query_DNA-Sequence
ttacatcctctgttggaaattctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaataattaagttcgcctttttcacaagTttcgagttcta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_103|beg|447|length|134|forward|gi
Query_DNA-Sequence
ataaacggcatagggggccgtggccccttatgtaatcttTcgagatccctaatgtcagtatattggtttttcctgtcactaggcccctctcccgaatgatcgaatccaaattcccttaactcTtaatgtcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_104|beg|1722|length|102|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcTactaaatgggtcgagcatgatcatcacTtaaagctatcaagataaa

Coding-DNA-Entry-Section

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824

Coding-DNA
gtccataaaatcattaattgacccgaatccttttagtagttctttagctttttcT
Protein-Sequence
SIKSLIDPNPFSSSLAFS
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 3 from: 173724 to: 173777
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187777 to: 187824


Query-DNA-Entry-Section

Query-DNA-Def dare_106|beg|346|length|125|forward|gi
Query_DNA-Sequence
caccttcttaacggtaagtccttagcatctatgtcaaagacgagttcagtcctaaccatcccctccatttcctggggcttctcataaaagtgcaacgctggaataaacggcatagggggccgtgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_108|beg|341|length|104|forward|gi
Query_DNA-Sequence
gctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatTaaagtgcaac

Coding-DNA-Entry-Section

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296

Coding-DNA
ctcgcaccttcttaacggTtTaagtcccttagcatctatgtcaaagacgagttcagtccctaaccatccctccatttcctggggcttctcatT
Protein-Sequence
SHLLNGLSPLASMSKTSSVPNHPSISWGFSL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186417 to: 186485
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7004 to: 7066
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 234 to: 296


Query-DNA-Entry-Section

Query-DNA-Def dare_114|beg|1699|length|124|forward|gi
Query_DNA-Sequence
aacgctaactatttttggaattgcgtccataaaatcattaattgacccgaatccttttaTgtagttctttagctttttcactaaatgggcgaTgcatgatTcatcactaagctatcaagataaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_115|beg|897|length|131|forward|gi
Query_DNA-Sequence
gaggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacagtcttaaccctaacgTttcctTccttggtgggtttggacagattcttgcatagct

Coding-DNA-Entry-Section

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119

Coding-DNA
aggtgagcatctatttgcggcttcaattattatcggtaaaatttcctcagttattactctaagtccttttatacag
Protein-Sequence
DCIKGLRVITEEILPIIIEAANRCSP
Hit-Information Section
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7544 to: 7621
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186948 to: 187025
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599042 to: 1599119


Query-DNA-Entry-Section

Query-DNA-Def dare_116|beg|1617|length|129|forward|gi
Query_DNA-Sequence
gatccattacgttatcttgTatctaaaaacttgtctatcagtttctcattttttactaccctaatTcctttctatcacatcgtcaacgctaactatttttggaattTgcgtccataaaatcattaattg

Coding-DNA-Entry-Section

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156

Coding-DNA
atccattacgttatcttgTatctaaaaacttgtctatcagtttctcatttt
Protein-Sequence
IHYVILYLKTCLSVSHF
Hit-Information Section
gi-nr: gi|70778703 gi_def: Mus musculus BAC clone RP24-356O12 from chromosome 19, complete sequence hsp_num: 1 from: 78109 to: 78156


Query-DNA-Entry-Section

Query-DNA-Def dare_121|beg|748|length|141|forward|gi
Query_DNA-Sequence
ttgtggggcgttagcccttTatcttttcacagttttgggggaaagtaccaggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttgatctcattgggttgatc

Coding-DNA-Entry-Section

Coding-DNA
ggtggaatttccgctgtcttcgaggctaggatttgctgtatTatccaaatccgaggtggtaccagatattcttg
Protein-Sequence
PGGISAVFEARICCIIQIRGGTRYS*S
Hit-Information Section
gi-nr: gi|47118297 gi_def: Pyrococcus horikoshii OT3 DNA, complete genome hsp_num: 5 from: 172781 to: 172837


Query-DNA-Entry-Section

Query-DNA-Def dare_122|beg|1722|length|112|forward|gi
Query_DNA-Sequence
cgtccataaaatcattaattgaTcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatcatcactaaagctTatcaagataaaatgttaacgg

Coding-DNA-Entry-Section

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440

Coding-DNA
Tcccgaatccttttagtagttctttagctttttcactaaatgggtcgagcatgatc
Protein-Sequence
MIMLDPFSEKAKELLKGFGI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 187791 to: 187847
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 8390 to: 8440


Query-DNA-Entry-Section

Query-DNA-Def dare_123|beg|1128|length|128|forward|gi
Query_DNA-Sequence
gttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaaggcttggatttcacccagaactttcctgtagaattctgggagttcatctctaatttcgtaaagcatgtttacgccc

Coding-DNA-Entry-Section

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216

Coding-DNA
ttttcctccttgaatctctccgaattttcttccaaactcttcctccgcaaa
Protein-Sequence
FSSLNLSEFSSKLFLRK
Hit-Information Section
gi-nr: gi|84042548 gi_def: Rhesus Macaque BAC CH250-405K12 (Children's Hospital Oakland Research Institute Rhesus macaque Adult Male BAC Library) complete sequence hsp_num: 2 from: 122178 to: 122216


Query-DNA-Entry-Section

Query-DNA-Def dare_124|beg|1098|length|129|forward|gi
Query_DNA-Sequence
taatacaagggggaaagaactccggccttagttttcctccttgaatctctccgaattttcttccaaactcttcctcccgcaaaggcttggatttcacccagaactttcctgtagaattctTgggagttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_128|beg|232|length|102|forward|gi
Query_DNA-Sequence
atgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacatactgTttTc

Coding-DNA-Entry-Section

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429

Coding-DNA
tgatatgtatgtcattgaatcctaactcctcccttagtattattacggtatccctcactatctccttagcgtcgtttaagcaaattggacat
Protein-Sequence
VCPICLNDAKEIVRDTVIILREELGFNDIHI
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186284 to: 186376
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6871 to: 6966
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 334 to: 429


Query-DNA-Entry-Section

Query-DNA-Def dare_129|beg|1356|length|127|forward|gi
Query_DNA-Sequence
catcgggaactagatcTtaggaagtcagagatcttTcattgtgtactctggaattttaccgtaaactctttcaattttccttacatcctctgttggaaattctatggcggtgctcacatcaatgctt

Coding-DNA-Entry-Section

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515

Coding-DNA
tctttcaattttccttacatcctctgttggaaattctatggcggtgctc
Protein-Sequence
TLSIFLTSSVGNSMAVL
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187438 to: 187515


Query-DNA-Entry-Section

Query-DNA-Def dare_130|beg|551|length|135|forward|gi
Query_DNA-Sequence
caaattcccttaactctaatgtTcttTcacaatgaaatctggtTatgtccttaaccttccattcattggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctTccaggta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_131|beg|98|length|123|forward|gi
Query_DNA-Sequence
gaagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattTcatccaaaactctaatatggtaac

Coding-DNA-Entry-Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttg
Protein-Sequence
SFLNSSTSSISLAETNDKNSFPWTSNLA*G
Hit-Information Section

Coding-DNA
aagttttctgaactcttcaacatcctcgatttcactagcagaaacaaatgacaaaaattctttcccTtggacttcgaatctagcttgagggcccattT
Protein-Sequence
MKWALKLDSKSKGKNFCHLFLLVKSRMLKSSENF
Hit-Information Section
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 2 from: 469 to: 501
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 6799 to: 6831
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186212 to: 186241


Query-DNA-Entry-Section

Query-DNA-Def dare_132|beg|1398|length|126|forward|gi
Query_DNA-Sequence
actctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgctcacatcaatgcttatctcctccggcttgatctccttttttctttttagtctctct

Coding-DNA-Entry-Section

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599

Coding-DNA
ctctggaatttttaccgtaaactctttcaattttccttacatcctctttggaaattcctatggcggtgc
Protein-Sequence
LWNFYRKLFQFSLHPLWKFLWRC
Hit-Information Section
gi-nr: gi|10122135 gi_def: Homo sapiens BAC clone CTB-137N13 from 7, complete sequence hsp_num: 1 from: 24635 to: 24667
gi-nr: gi|118142807 gi_def: Pan troglodytes BAC clone CH251-26L21 from chromosome 7, complete sequence hsp_num: 1 from: 168567 to: 168599


Query-DNA-Entry-Section

Query-DNA-Def dare_133|beg|369|length|134|forward|gi
Query_DNA-Sequence
agcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttctcataaagtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatccctaatgt

Coding-DNA-Entry-Section

Coding-DNA
gcatctatgtcaaagacgagttcagtccctaacccatccctccatttcctggggcttc
Protein-Sequence
HLCQRRVQSLTHPSISWGF
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081

Coding-DNA
gtgcaacgctgggaataaacggcatagggggccTgtggcccttatgtaatcttcgagatcccta
Protein-Sequence
SATLGINGIGGLWPLCNLRDP*C
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 3 from: 186450 to: 186494
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 3 from: 219 to: 260
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 3 from: 7040 to: 7081


Query-DNA-Entry-Section

Query-DNA-Def dare_135|beg|1183|length|133|forward|gi
Query_DNA-Sequence
ttggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccctcttgag

Coding-DNA-Entry-Section

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
LDFTQNFPVEFWEFSLIFVKHVYAPFHIPLKGFCSISLLDLP
Hit-Information Section
gi-nr: gi|38323096 gi_def: Mouse DNA sequence from clone RP23-221A16 on chromosome 4 Contains the 3' end of the gene for a novel immunoglobulin domain containing protein, complete sequence hsp_num: 1 from: 50870 to: 50932

Coding-DNA
tggatttcacccagaactttcctgtagaattctgggagttctctctaattttcgtaaagcatgtttacgcccctttccacattcctctcaaaggctttTgctccatatccttattagatcttccc
Protein-Sequence
GFHPELSCRILGVLSNFRKACLRPFPHSSQRLLLHILIRSSL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_137|beg|1246|length|108|forward|gi
Query_DNA-Sequence
gtttacgTcccctttTccacattcctctcaaaTggctttgctccatatccttattaTgatcttcccctgaggtacacacgcccttcgtatatgtaatagttcgctaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_142|beg|1222|length|137|forward|gi
Query_DNA-Sequence
ttcatctctaatttcgtaaagcatgtttacgcccctttccacattcctctcaaggctttTgctccatatccttattagatcttccctcttgaggtacacacgcccttcgtatTatgTtaatTagttcgctaactttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_143|beg|627|length|102|forward|gi
Query_DNA-Sequence
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299

Coding-DNA
ctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggttaacctccttaaataatacgtcaatggatttctgatgtattta
Protein-Sequence
CKYIRNPLTYYLRRLTWREEGMLLREVTREERK
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186732 to: 186779
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 186677 to: 186730
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7313 to: 7375
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 2 from: 7267 to: 7299


Query-DNA-Entry-Section

Query-DNA-Def dare_144|beg|667|length|113|forward|gi
Query_DNA-Sequence
tcttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagcccttatcttttTcacag

Coding-DNA-Entry-Section

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350

Coding-DNA
cttccctccaggtataacctccttaaataatacgtcaatggatttctgatgtatttacagtgcttatcgggagtgcacaattgtggggcgttagccctt
Protein-Sequence
IRANAPQLCTPDKHCKYIRNPLTYYLRRLYLEGR
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186717 to: 186821
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7319 to: 7417
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599246 to: 1599350


Query-DNA-Entry-Section

Query-DNA-Def dare_145|beg|787|length|130|forward|gi
Query_DNA-Sequence
aagtacaggtggaatttccgctgtcttcgaggctaggatttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctatttgcg

Coding-DNA-Entry-Section

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179

Coding-DNA
atttgctgtTatatccaaatccgaggtggtaccagatattcttgatctcattgggttgatccTtcaaataatggaggtgagcatctattt
Protein-Sequence
QIDAHLHYLKDQPNEIKNIWYHLGFGYNSKS
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186879 to: 186938
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 7475 to: 7534
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599129 to: 1599179


Query-DNA-Entry-Section

Query-DNA-Def dare_148|beg|628|length|104|forward|gi
Query_DNA-Sequence
tttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctccttTaaataatacgtcaatggatttctgatgtatttacagtg

Coding-DNA-Entry-Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section

Coding-DNA
ttctttcctctcttgttacctcTtcttaggagcattccttcttccctccaggtataacctcct
Protein-Sequence
SFLSCYLFLGAFLLPSRYNLL
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_149|beg|1569|length|117|forward|gi
Query_DNA-Sequence
catTagggtgagtaggatagggcccccaatagggcatagaattgTagctagatccattacgttatcttgatctaaaaacttgtctatTcagtttctcattttttactaccctaaTtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_150|beg|956|length|110|forward|gi
Query_DNA-Sequence
ctaatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggtaattgcTatagttccta

Coding-DNA-Entry-Section

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062

Coding-DNA
taatgtcctttatacagtctttaacctaacgttcctccttggtgggtttggacagattcttgatagctcaaaaagctcgtcaataatacggta
Protein-Sequence
NVLYTVFNLTFLLGGFGQILDSSKSSSIIR*L
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 2 from: 187033 to: 187062


Query-DNA-Entry-Section

Query-DNA-Def dare_151|beg|401|length|136|forward|gi
Query_DNA-Sequence
accatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaTtgtaatcttcgagatcccctaatgTtcagtatattggtttttcctgtcactaggcccct

Coding-DNA-Entry-Section

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169

Coding-DNA
ccatccctccatttcctggggcttctcataaagtgcaacgctggaataaacTggcatagggggccgtggcccttaT
Protein-Sequence
PSLHFLGLLIKCNAGINWHRGPWPLL
Hit-Information Section
gi-nr: gi|61098277 gi_def: Gallus gallus epsin 2 (EPN2), mRNA hsp_num: 1 from: 74 to: 142
gi-nr: gi|53127405 gi_def: Gallus gallus mRNA for hypothetical protein, clone 2d1 hsp_num: 1 from: 101 to: 169


Query-DNA-Entry-Section

Query-DNA-Def dare_153|beg|598|length|141|forward|gi
Query_DNA-Sequence
ttaaccttccattcaTttggtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataacctccttaaataatacgtcTaatggatttctgatgtatttacagtgcttatcg

Coding-DNA-Entry-Section

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748

Coding-DNA
gtgtaaaagttctttctttcctctcttgttacctctcttaggagcattccttcttccctccaggtataa
Protein-Sequence
GYTWREEGMLLREVTREERKNFYT
Hit-Information Section
gi-nr: gi|5457433 gi_def: Pyrococcus abyssi complete genome; segment 1/6 hsp_num: 1 from: 186665 to: 186748


Query-DNA-Entry-Section

Query-DNA-Def dare_159|beg|1496|length|140|forward|gi
Query_DNA-Sequence
tctTccttttttctttttagtctctctgaataaataattaagTtttcgcctttttcacaagttcgagttctataccatagggtgagtaggatagggcccccaatagggcatagaattgagctagatccattacgttatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_161|beg|141|length|122|forward|gi
Query_DNA-Sequence
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgatagtatgtcattgaatcctaactcctc

Coding-DNA-Entry-Section

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522

Coding-DNA
aacaaatgaaaaattcttttccctggacttcgaatctagcttgagggcccattcatccaaaactctaatatggtaaccccttccagaatatatgat
Protein-Sequence
TIIYSGRGYHIRVLDEWALKLDSKSREKNFSFV
Hit-Information Section
gi-nr: gi|57158259 gi_def: Thermococcus kodakarensis KOD1 DNA, complete genome hsp_num: 1 from: 1599808 to: 1599903
gi-nr: gi|18892016 gi_def: Pyrococcus furiosus DSM 3638, section 12 of 173 of the complete genome hsp_num: 1 from: 6778 to: 6873
gi-nr: gi|9453868 gi_def: Pyrococcus furiosus priA gene for DNA primase, complete cds hsp_num: 1 from: 427 to: 522


Query-DNA-Entry-Section

Query-DNA-Def dare_165|beg|1453|length|137|forward|gi
Query_DNA-Sequence
ttctatggcggtgctcacatcaaTtgcttatctcctccggcttgatctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttcagttctTataccataggggagtaggatagg

Coding-DNA-Entry-Section

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360

Coding-DNA
tctccttttttctttttagtctctctgaataaaTtaattaagttcgcctttttcacaagttca
Protein-Sequence
*SPFFFLVSLNKLIKFAFFTSS
Hit-Information Section
gi-nr: gi|147809612 gi_def: Vitis vinifera contig VV78X265770.9, whole genome shotgun sequence hsp_num: 1 from: 1298 to: 1360


Query-DNA-Entry-Section

Query-DNA-Def dare_167|beg|1547|length|107|forward|gi
Query_DNA-Sequence
ttcacaagttcgagttctatTaccatagggtgagtaggatagggccccccaatagggcatTagaattgagctagatccattacgttatcttgatctaaaaacttgtc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_001|beg|2512|length|120|forward|gi
Query_DNA-Sequence
tctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttgacc

Coding-DNA-Entry-Section

Coding-DNA
ctgTtccaccaattaaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccatcaccttga
Protein-Sequence
GQGDGERNKIFAEAFGRDAEFFAFYRAMQAYETAFNWWNR
Hit-Information Section
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417142 to: 2417237
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610373 to: 3610468


Query-DNA-Entry-Section

Query-DNA-Def dare_002|beg|2211|length|144|forward|gi
Query_DNA-Sequence
caaaaaatataataaaataattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccacttcttaatttgtgaatcTtttatcatctTccatttttttttaacat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_007|beg|268|length|107|forward|gi
Query_DNA-Sequence
taaattcagatttagtcttagctaaccaatcatacatagatatattgtataagatttaatctcataagctcttatggactttggtatcatttggatcaaatttgtct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_011|beg|1665|length|122|forward|gi
Query_DNA-Sequence
tgtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt

Coding-DNA-Entry-Section

Coding-DNA
gtaacttataacggagacagtccgattgatctatttcttgctgtattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccTaattcttgctt
Protein-Sequence
KQELGDWVIAIGNPFGLGGTVTAGIIQQEIDQSDCLRYKL
Hit-Information Section
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887137 to: 1887214
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 2 from: 2802806 to: 2802883
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355953 to: 1356030
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349251 to: 1349328
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8553 to: 8630
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367346 to: 1367423
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364496 to: 1364573
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 489285 to: 489362
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836329 to: 2836406
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456492 to: 3456569
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165081 to: 7165158
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785844 to: 5785915
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683226 to: 683303
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219544 to: 3219621
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322989 to: 6323066
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 3168642 to: 3168713
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946774 to: 2946851
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757259 to: 5757336
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151682 to: 2151759
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418444 to: 2418521
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250103 to: 2250180
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713911 to: 3713988
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997510 to: 1997587
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609103 to: 3609180
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3949530 to: 3949607
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168194 to: 1168262
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320873 to: 2320950
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246280 to: 246357
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 550628 to: 550705
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71227 to: 71304
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62585 to: 62662
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 848 to: 925
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 821 to: 898
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667639 to: 1667716
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 2 from: 164754 to: 164825
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432575 to: 432640
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367887 to: 6367964
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211350 to: 1211427
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 3977259 to: 3977324
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663790 to: 2663867
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 2 from: 1013990 to: 1014058
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617902 to: 2617979
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552048 to: 3552125
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917630 to: 3917698
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625378 to: 1625455
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 3004488 to: 3004565
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340230 to: 1340298
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294304 to: 2294381
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266551 to: 266619
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170820 to: 170888
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497381 to: 1497449
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 3402718 to: 3402786
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991977 to: 992045
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1866553 to: 1866621
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5742 to: 5819
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966525 to: 966602
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 2002161 to: 2002229
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556193 to: 2556261
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563305 to: 1563382
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 2 from: 867750 to: 867815
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973562 to: 2973639
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302025 to: 1302102
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205095 to: 2205163
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 1038097 to: 1038165
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99410 to: 99487
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69430 to: 69507
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838175 to: 3838243
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1347106 to: 1347171
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 464956 to: 465033
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434048 to: 434119
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360580 to: 2360648
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933533 to: 1933604
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6508 to: 6576
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 1481604 to: 1481672
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472412 to: 1472477
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119358 to: 1119435
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299953 to: 300030
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 525 to: 596
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360485 to: 360556
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 812523 to: 812594
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209940 to: 1210008
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455231 to: 2455302
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193379 to: 1193447
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206735 to: 1206803
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852865 to: 852936
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707251 to: 1707316
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968960 to: 969028
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730842 to: 4730913
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 752 to: 820
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227875 to: 3227946
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192123 to: 2192200
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634431 to: 634499
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970353 to: 970424
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79057 to: 79128
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967615 to: 967686
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927065 to: 927130
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881028 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90043
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273794 to: 273865
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219050 to: 219121
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946806 to: 946877
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246511 to: 246582
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124538 to: 1124609
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120943 to: 1121014
gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 896671 to: 896742
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576887 to: 576955
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725706 to: 1725771
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427034 to: 427102
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780576 to: 1780644
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799750 to: 2799818
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750324 to: 2750392
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837587 to: 2837655
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462275 to: 2462343
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564603 to: 564671
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210100 to: 3210168
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 501552 to: 501617
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647528
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777118
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2244783 to: 2244854
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939965 to: 2940033
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934462 to: 1934530
gi-nr: gi|33238865 gi_def: Prochlorococcus marinus subsp. marinus str. CCMP1375 complete genome hsp_num: 1 from: 116489 to: 116560
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 1119186 to: 1119251
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3095258 to: 3095326
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696481 to: 696546
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 2 from: 754658 to: 754723
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 3267195 to: 3267266
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 559 to: 627
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978033 to: 3978101
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7924 to: 7992
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 953 to: 1021
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242058 to: 242126
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249322 to: 249390
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242049 to: 242117
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241163 to: 241231
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 335 to: 373
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829861 to: 829929
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619717 to: 3619785
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239147 to: 3239215
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913587 to: 3913655
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651877 to: 3651945
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796537 to: 796605
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903457 to: 3903525
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259710 to: 259778
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343281 to: 1343352
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428584 to: 1428649
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1933 to: 1998
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688687 to: 688752
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087596 to: 4087664
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 3457286 to: 3457351
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253502 to: 253570
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142957 to: 143022
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79450 to: 79515
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146093 to: 146158
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 1583819 to: 1583884
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252713 to: 252781
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502816 to: 2502884
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1374 to: 1442
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531144 to: 531212
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369821 to: 369889
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53608 to: 53679
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979313 to: 3979381
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350811 to: 4350879
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481613 to: 2481678
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189185 to: 4189253
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935880 to: 3935948
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149077 to: 149145
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180877 to: 4180945
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16885 to: 16953
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 100 to: 138
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264307
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264227 to: 1264265
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 514 to: 582
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767214 to: 5767279
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808372 to: 808437
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238515
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147992 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147452 to: 147490
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914076 to: 914141
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4770 to: 4808
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191807
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226813 to: 226881


Query-DNA-Entry-Section

Query-DNA-Def dare_012|beg|1640|length|134|forward|gi
Query_DNA-Sequence
gagtttattgTatgcatcagtttgaatgtaatcttTcaTtaacgagacagtTccgattgatcTtatttcttgctgatattattcctcagtaaccgttcctcctaagccaaaggggattgccgattgcgataacc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_013|beg|638|length|128|forward|gi
Query_DNA-Sequence
atataaatgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttgtaaacctgcatactgtTcggattgatgattttctccttcaatttttttttgcaatctta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_014|beg|1004|length|113|forward|gi
Query_DNA-Sequence
taatctattgggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_015|beg|776|length|109|forward|gi
Query_DNA-Sequence
tgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagTcttaacaccaatatatcTttcttggttttgattattgtaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_016|beg|2747|length|104|forward|gi
Query_DNA-Sequence
tctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc

Coding-DNA-Entry-Section

Coding-DNA
ctttccctttcagtctgattcttctataaattgcatcactgtttgcttgtggaaggtccgctcttttaattctaacatctactattttaattccaaaactttc
Protein-Sequence
ESFGIKIVDVRIKRADLPQANSDAIYRRIRLKGK
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797881 to: 797970
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205782 to: 1205871
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 11010 to: 11093
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011138 to: 1011221
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353700 to: 1353789
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080087 to: 1080176
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 582399 to: 582482
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2619018 to: 2619065


Query-DNA-Entry-Section

Query-DNA-Def dare_017|beg|456|length|117|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaatttttaactagTtccattgattaatgattgaaaatatagacctgttccaccTaactaaaattggaattttttttctttttttTgaatat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_018|beg|2521|length|119|forward|gi
Query_DNA-Sequence
caaTttaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaatttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTcaccttgacccTttcatg

Coding-DNA-Entry-Section

Coding-DNA
ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc
Protein-Sequence
NLHLFQRLLQKILFLSPF
Hit-Information Section
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107

Coding-DNA
ttgcatctcttccaaaggcttctgcaaaagatcttatttctttcaccatTc
Protein-Sequence
NLHLFQRLLQKILFLSPF
Hit-Information Section
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26264 to: 26314
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65107


Query-DNA-Entry-Section

Query-DNA-Def dare_020|beg|1843|length|119|forward|gi
Query_DNA-Sequence
gactgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgattaa

Coding-DNA-Entry-Section

Coding-DNA
actgcaatatcaagataagggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcattttgTaataacatgattgttagtgatt
Protein-Sequence
LQYQDKGSAPTTVALYSLSPSTRTKISSAFCNNMIVSD*
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_024|beg|2741|length|116|forward|gi
Query_DNA-Sequence
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaacatctactattttaattccaaaactttcagct

Coding-DNA-Entry-Section

Coding-DNA
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca
Protein-Sequence
MLELKEADLPQSNSDAIYRRMQTEREREA
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197
gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77

Coding-DNA
tgcttctctttccctttcagtctgcattcttctataaattgcatcactgttgcttTgtggaaggtccgcTtcttttaattctaaca
Protein-Sequence
MLELKEADLPQSNSDAIYRRMQTEREREA
Hit-Information Section
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 797923 to: 797991
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2662623 to: 2662691
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1011174 to: 1011242
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 10989 to: 11057
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2319228 to: 2319296
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 101036 to: 101104
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 133155 to: 133220
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1205824 to: 1205892
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7166465 to: 7166533
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2416962 to: 2417030
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3715438 to: 3715506
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3005930 to: 3005998
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 2569738 to: 2569806
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6324517 to: 6324585
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1388179 to: 1388247
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1366267 to: 1366335
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1353742 to: 1353810
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1265178 to: 1265246
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1239384 to: 1239452
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147026 to: 147094
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 146486 to: 146554
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 3812 to: 3880
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610580 to: 3610648
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080129 to: 1080197
gi-nr: gi|1871863 gi_def: R.prowazekii genomic DNA fragment (clone A794F) hsp_num: 1 from: 9 to: 77


Query-DNA-Entry-Section

Query-DNA-Def dare_025|beg|2094|length|123|forward|gi
Query_DNA-Sequence
ttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacTttattgcaaaa

Coding-DNA-Entry-Section

Coding-DNA
tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISTTTTVTT
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286

Coding-DNA
tgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISTTTTVTT
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552459 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171225 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360961 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293955
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286


Query-DNA-Entry-Section

Query-DNA-Def dare_026|beg|2198|length|139|forward|gi
Query_DNA-Sequence
gcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaactttttatataccaataattataaaaaccTtataactgcaaaaattaacccaccacttcttaattgtgaatcttttaTtcTatc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_027|beg|1217|length|117|forward|gi
Query_DNA-Sequence
gtaatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatttttcatctctttaatcttagtgttattaaactcta

Coding-DNA-Entry-Section

Coding-DNA
taatctctcttttatttctccagattttaacatctacTaTgttttaccaacttctgtttgtgcaacaattattggtaaatt
Protein-Sequence
NLSFISPDFNIYYVLPTSVCATIIGKF
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_028|beg|32|length|137|forward|gi
Query_DNA-Sequence
aattgatattaactTcttctgcttTcatccaaggtaaTtttcatcaTtttagatTactgtgtcaattcggcaatcccaaTttaccttgtttacactctgatTcttttttaatttttagtttaagaaattttttaact

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_029|beg|2108|length|115|forward|gi
Query_DNA-Sequence
gtcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgaaaacttattgcaaaaaatataata

Coding-DNA-Entry-Section

Coding-DNA
tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISKR
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286

Coding-DNA
tcgtttagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVNISKR
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668098 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663456
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118572 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086085 to: 2086153
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552453 to: 3552518
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556628 to: 2556696
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366132 to: 366191
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2988795 to: 2988851
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171219 to: 171284
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904142 to: 904210
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618340 to: 2618399
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127050
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360955 to: 2361020
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837808
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293961
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835286


Query-DNA-Entry-Section

Query-DNA-Def dare_030|beg|1689|length|105|forward|gi
Query_DNA-Sequence
cgattgatctatttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataacccaatcaccaattcttgcttgatcTagaa

Coding-DNA-Entry-Section

Coding-DNA
tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc
Protein-Sequence
LGYAIGNPFGLGGTVTAGIISKK*I
Hit-Information Section
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2663817 to: 2663870
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 4 from: 2961597 to: 2961650
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792
gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209
gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529
gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973
gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606
gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656
gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325
gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172
gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648
gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573
gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784
gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285
gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779
gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658
gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455
gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695
gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634
gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686
gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616
gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670
gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876
gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886
gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378
gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585
gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586
gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726
gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581
gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227
gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696
gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959
gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755
gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415
gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669
gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666
gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195
gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595
gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162
gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389
gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876
gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411
gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034
gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890
gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780
gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440
gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515
gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335
gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251
gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519
gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488
gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448
gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602
gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869
gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423
gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002
gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779
gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739
gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130
gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368
gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769

Coding-DNA
tttcttgctgattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcataaccc
Protein-Sequence
LGYAIGNPFGLGGTVTAGIISKK*I
Hit-Information Section
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556184 to: 2556243
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 5 from: 3093229 to: 3093282
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887164 to: 1887223
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 2802797 to: 2802856
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 5 from: 2075316 to: 2075369
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367337 to: 1367396
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 622156 to: 622215
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 4 from: 1203451 to: 1203504
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364487 to: 1364546
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 618453 to: 618512
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 4 from: 1200602 to: 1200655
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355944 to: 1356003
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 622118 to: 622177
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 4 from: 1191131 to: 1191184
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349242 to: 1349301
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 600659 to: 600718
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 4 from: 1185343 to: 1185396
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8580 to: 8639
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563332 to: 1563391
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 3 from: 867747 to: 867800
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 4 from: 899887 to: 899934
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 991995 to: 992054
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 3 from: 1866544 to: 1866603
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1625405 to: 1625458
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 3 from: 3004479 to: 3004538
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 4 from: 1775731 to: 1775784
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838193 to: 3838252
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205086 to: 2205145
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 1038115 to: 1038168
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 4 from: 1931567 to: 1931620
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302052 to: 1302105
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 2567833 to: 2567892
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 5 from: 1516455 to: 1516508
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667630 to: 1667689
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 3 from: 432590 to: 432649
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 4 from: 164745 to: 164804
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5702 to: 5761
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 1014008 to: 1014067
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 3 from: 2663817 to: 2663870
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 4 from: 2961597 to: 2961650
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209958 to: 1210017
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 4 from: 2978196 to: 2978249
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 5 from: 2455222 to: 2455281
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1205468 to: 1205527
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 3 from: 550655 to: 550714
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 5 from: 1141510 to: 1141563
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 1 from: 1012031 to: 1012090
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 3 from: 489312 to: 489371
gi-nr: gi|49239191 gi_def: Bartonella quintana str. Toulouse, complete genome hsp_num: 5 from: 951462 to: 951515
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948747 to: 948806
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437491 to: 437550
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 6 from: 726289 to: 726342
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69421 to: 69480
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360577 to: 2360630
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 3 from: 395064 to: 395120
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 683253 to: 683312
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 3 from: 1085107 to: 1085160
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340248 to: 1340307
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 2 from: 1170693 to: 1170752
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 3 from: 2909896 to: 2909949
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1788721 to: 1788774
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 1 from: 246307 to: 246366
gi-nr: gi|51889361 gi_def: Zebrafish DNA sequence from clone RP71-62P22 in linkage group 25, complete sequence hsp_num: 1 from: 62576 to: 62635
gi-nr: gi|951169 gi_def: Rhizobium meliloti RmDEGP (degP) gene, complete cds hsp_num: 1 from: 875 to: 934
gi-nr: gi|1263914 gi_def: Rochalimaea henselae antigen (htrA) gene, complete cds hsp_num: 1 from: 848 to: 907
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917648 to: 3917707
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170817 to: 170870
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617899 to: 2617952
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 1497399 to: 1497458
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 1316361 to: 1316420
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 3 from: 3402715 to: 3402768
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 1897371 to: 1897424
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 6 from: 1972462 to: 1972515
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 1168212 to: 1168271
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3949527 to: 3949580
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 3 from: 2320900 to: 2320959
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 4 from: 2671928 to: 2671981
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266542 to: 266601
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 6367914 to: 6367973
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 1211341 to: 1211400
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 3219571 to: 3219624
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 6322980 to: 6323039
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 3 from: 8194171 to: 8194224
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 3168639 to: 3168692
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 5 from: 5156490 to: 5156546
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 6 from: 5267408 to: 5267461
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 2946801 to: 2946854
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 5757250 to: 5757309
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 5 from: 4827015 to: 4827068
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2151709 to: 2151762
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 2418471 to: 2418530
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 3 from: 3980333 to: 3980386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2250130 to: 2250183
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3713902 to: 3713961
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 3 from: 3509680 to: 3509733
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 1997537 to: 1997590
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3609094 to: 3609153
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 3805639 to: 3805692
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71254 to: 71307
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 2836356 to: 2836409
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 3456519 to: 3456572
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 3 from: 7165072 to: 7165131
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 4 from: 5785865 to: 5785918
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 5915272 to: 5915325
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 464983 to: 465036
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 3 from: 1347103 to: 1347156
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 4 from: 2804870 to: 2804923
gi-nr: gi|17739357 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 88 of 256 of the complete sequence hsp_num: 1 from: 5769 to: 5828
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 966552 to: 966611
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 3 from: 1892739 to: 1892792
gi-nr: gi|122831090 gi_def: Brucella melitensis HtrA (htrA) gene, complete cds hsp_num: 1 from: 640 to: 699
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294319 to: 2294372
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 2 from: 855153 to: 855209
gi-nr: gi|17983317 gi_def: Brucella melitensis 16M chromosome I, section 128 of 195 of the complete sequence hsp_num: 1 from: 8470 to: 8529
gi-nr: gi|497156 gi_def: Brucella abortus htrA gene, complete cds hsp_num: 1 from: 914 to: 973
gi-nr: gi|144117 gi_def: Brucella abortus immunoreactive stress response protein gene, complete cds hsp_num: 1 from: 972 to: 1031
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 1 from: 770 to: 823
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119385 to: 1119438
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 299980 to: 300033
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552045 to: 3552098
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 3 from: 562 to: 621
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2714659 to: 2714718
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 434039 to: 434098
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99401 to: 99460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777256 to: 777318
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973559 to: 2973609
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 2 from: 1428966 to: 1429019
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 2989233 to: 2989292
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 4 from: 1827947 to: 1828003
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 3 from: 1722970 to: 1723029
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229222 to: 229275
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 3 from: 10074 to: 10133
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857901 to: 857960
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 3 from: 1149162 to: 1149215
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 4 from: 7098704 to: 7098757
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 134020 to: 134073
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1482690 to: 1482743
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227866 to: 3227925
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 1 from: 553 to: 606
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974159 to: 974212
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012104 to: 1012163
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 197294 to: 197347
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798856 to: 798915
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502834 to: 2502887
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 3 from: 750231 to: 750284
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888597 to: 888650
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 887125 to: 887178
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971899 to: 2971952
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276119 to: 4276172
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 182800 to: 182853
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711335 to: 3711388
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712753 to: 3712806
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 180328 to: 180381
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3424838 to: 3424891
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426256 to: 3426309
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 1747264 to: 1747317
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095255 to: 3095308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557315 to: 3557368
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 3 from: 3558731 to: 3558784
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871545 to: 871598
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842051 to: 842104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 840601 to: 840654
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208241 to: 208294
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992804 to: 3992857
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994211 to: 3994264
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 291880 to: 291933
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 834665 to: 834718
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 577 to: 630
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 91230 to: 91283
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829858 to: 829911
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 828393 to: 828446
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798159 to: 798212
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976631 to: 3976684
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978051 to: 3978104
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346163 to: 346216
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939765 to: 3939818
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 3941237 to: 3941290
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 600445 to: 600498
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276978 to: 4277031
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913605 to: 3913658
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 3915070 to: 3915123
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651895 to: 3651948
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653310 to: 3653363
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325626 to: 325679
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806745 to: 806798
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 805285 to: 805338
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 634449 to: 634502
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 677632 to: 677688
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 3 from: 2192150 to: 2192209
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338792 to: 4338845
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187254 to: 187307
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3663829 to: 3663882
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665247 to: 3665300
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011480 to: 4011533
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796534 to: 796587
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795074 to: 795127
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903475 to: 3903528
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904935 to: 3904988
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 909786 to: 909839
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172787 to: 172840
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331780 to: 3331833
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333198 to: 3333251
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186683 to: 186736
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3482850 to: 3482903
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 3 from: 3484268 to: 3484321
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615266 to: 615319
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573693 to: 573746
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187278 to: 187331
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3590917 to: 3590970
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592335 to: 3592388
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173116 to: 173169
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369123 to: 3369176
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370521 to: 3370574
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 927062 to: 927115
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881025 to: 881078
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 2 from: 386553 to: 386606
gi-nr: gi|12721018 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 77 of 204 of the complete genome hsp_num: 1 from: 9246 to: 9299
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259728 to: 259781
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381105 to: 3381158
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382523 to: 3382576
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181457 to: 181510
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379272 to: 3379325
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380690 to: 3380743
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577189 to: 577242
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7942 to: 7995
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206753 to: 1206806
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191796 to: 191849
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804731 to: 3804784
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 3 from: 3806149 to: 3806202
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427031 to: 427084
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439262 to: 439315
gi-nr: gi|2623991 gi_def: Bradyrhizobium japonicum degP gene hsp_num: 1 from: 546 to: 599
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 971 to: 1024
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172603 to: 172656
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359205 to: 3359258
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360603 to: 3360656
gi-nr: gi|46914592 gi_def: Photobacterium profundum SS9; segment 11/12 hsp_num: 1 from: 191840 to: 191893
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89993 to: 90046
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242076 to: 242129
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 956 to: 1009
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535218 to: 2535271
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 1707266 to: 1707325
gi-nr: gi|47118325 gi_def: Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis DNA, complete genome hsp_num: 1 from: 168289 to: 168342
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185656 to: 185709
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116486 to: 4116539
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117904 to: 4117957
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 508 to: 561
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249340 to: 249393
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322482 to: 3322535
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087614 to: 4087667
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 4089074 to: 4089127
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242067 to: 242120
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355027 to: 3355080
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241181 to: 241234
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470665 to: 3470718
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 1336480 to: 1336533
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1119 to: 1172
gi-nr: gi|2935167 gi_def: Haemophilus influenzae strain NTHi 33 HtrA gene, complete cds hsp_num: 1 from: 595 to: 648
gi-nr: gi|2935165 gi_def: Haemophilus influenzae strain NTHi 12 HtrA gene, partial cds hsp_num: 1 from: 454 to: 507
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185657 to: 185710
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183703 to: 4183756
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12532 to: 12585
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 182437 to: 182490
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165269 to: 3165322
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166687 to: 3166740
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 968978 to: 969031
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 576905 to: 576958
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 925534 to: 925587
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167486 to: 167539
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3161173 to: 3161226
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159755 to: 3159808
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196377 to: 196430
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3552943 to: 3552996
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554361 to: 3554414
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 574 to: 627
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730827 to: 1730883
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1175462 to: 1175518
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309485 to: 1309538
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730839 to: 4730892
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 4044069 to: 4044122
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933554 to: 1933607
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 3 from: 323678 to: 323731
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 3 from: 401268 to: 401321
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 914088 to: 914144
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1770240 to: 1770299
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 1133624 to: 1133683
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 2 from: 450852 to: 450905
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 1240426 to: 1240485
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 1094543 to: 1094602
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 2 from: 397638 to: 397691
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 695790 to: 695849
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 1176374 to: 1176433
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 2 from: 399992 to: 400045
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 3267192 to: 3267245
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 2 from: 1874893 to: 1874952
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246532 to: 246585
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253520 to: 253573
gi-nr: gi|34481776 gi_def: Wolinella succinogenes, complete genome; segment 7/7 hsp_num: 1 from: 16871 to: 16927
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252731 to: 252784
gi-nr: gi|1071657 gi_def: Rickettsia typhi gene for 47 kDa protein, complete cds hsp_num: 1 from: 1367 to: 1426
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1371 to: 1424
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 1113232 to: 1113285
gi-nr: gi|1220500 gi_def: Rickettsia tsutsugamushi (strain Kp47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220498 gi_def: Rickettsia tsutsugamushi (strain Gm47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|1220496 gi_def: Rickettsia tsutsugamushi (strain Br47) gene, complete cds hsp_num: 1 from: 544 to: 603
gi-nr: gi|152452 gi_def: Rickettsia tsutsugamushi (clone Pkt5) 47 kDa protein gene, complete cds hsp_num: 1 from: 844 to: 903
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735531 to: 3735584
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531141 to: 531194
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529726 to: 529779
gi-nr: gi|151559145 gi_def: Cyanidioschyzon merolae DNA, chromosome 20, complete genome, complete sequence hsp_num: 1 from: 192884 to: 192940
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958841 to: 4958894
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044251 to: 1044304
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379739 to: 3379792
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369818 to: 369871
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367692 to: 367745
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 118701 to: 118754
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 2 from: 394320 to: 394379
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 2078314 to: 2078373
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 3013271 to: 3013324
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 1780567 to: 1780626
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2705502 to: 2705555
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 2799741 to: 2799800
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 2 from: 3626945 to: 3626998
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 2750315 to: 2750374
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 2 from: 3579715 to: 3579768
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2837605 to: 2837664
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 2 from: 1848944 to: 1848997
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 880197 to: 880250
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 862390 to: 862443
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090374 to: 4090427
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091788 to: 4091841
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 1992103 to: 1992156
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619708 to: 3619767
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 2462266 to: 2462325
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 2 from: 3215018 to: 3215071
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 3 from: 2851423 to: 2851476
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 1159274 to: 1159327
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53605 to: 53658
gi-nr: gi|104641438 gi_def: Karenia brevis plastid DegP serine-type peptidase precursor (DegP) mRNA, partial cds; nuclear gene for plastid product hsp_num: 1 from: 679 to: 735
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775157 to: 3775210
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979331 to: 3979384
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981457 to: 3981510
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 316013 to: 316066
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350829 to: 4350882
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352955 to: 4353008
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 589 to: 642
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207605 to: 3207658
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189182 to: 4189235
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187056 to: 4187109
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832300 to: 832353
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935898 to: 3935951
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938024 to: 3938077
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 1111949 to: 1112008
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 2 from: 3162528 to: 3162581
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903347 to: 903400
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149095 to: 149148
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151221 to: 151274
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3778339 to: 3778392
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858798 to: 3858851
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127420 to: 1127473
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 564621 to: 564680
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2796499 to: 2796552
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 362016 to: 362069
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92441 to: 92494
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3210091 to: 3210150
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 2 from: 4023994 to: 4024047
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970374 to: 970433
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 1 from: 6699 to: 6752
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273815 to: 273874
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219071 to: 219130
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946797 to: 946856
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 246711 to: 246770
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 788 to: 841
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 868396 to: 868455
gi-nr: gi|1419350 gi_def: Y.enterocolitica htrA gene hsp_num: 1 from: 530 to: 583
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900917 to: 900970
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180895 to: 4180948
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182310 to: 4182363
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 2939956 to: 2940015
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 2 from: 3730603 to: 3730656
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124559 to: 1124618
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967636 to: 967695
gi-nr: gi|17982714 gi_def: Brucella melitensis 16M chromosome I, section 76 of 195 of the complete sequence hsp_num: 1 from: 6579 to: 6632
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120964 to: 1121023
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 2 from: 1428581 to: 1428634
gi-nr: gi|50878229 gi_def: Zebrafish DNA sequence from clone RP71-84I2, complete sequence hsp_num: 1 from: 19586 to: 19639
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 59633 to: 59686
gi-nr: gi|55229667 gi_def: Haloarcula marismortui ATCC 43049 chromosome I, complete sequence hsp_num: 1 from: 262731 to: 262784
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934480 to: 1934539
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 2 from: 3423299 to: 3423352
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 435560 to: 435616
gi-nr: gi|497154 gi_def: Brucella abortus htrA-like protein gene, complete cds hsp_num: 1 from: 617 to: 670
gi-nr: gi|1526427 gi_def: Yersinia enterocolitica DNA for GsrA protein, complete cds hsp_num: 1 from: 823 to: 876
gi-nr: gi|154163176 gi_def: Bacillus cereus strain G9241 plasmid pBC210, complete sequence hsp_num: 2 from: 42801 to: 42857
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 2 from: 79078 to: 79137
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824420 to: 4824473
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 878776 to: 878829
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 3 from: 4825833 to: 4825886
gi-nr: gi|151421208 gi_def: Hordeum vulgare subsp. vulgare cDNA clone: FLbaf153h02, mRNA sequence hsp_num: 1 from: 246 to: 302
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 3649315 to: 3649368
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175249 to: 5175302
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1942847 to: 1942900
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 4944325 to: 4944378
gi-nr: gi|146448763 gi_def: Pseudomonas aeruginosa strain PA14 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|146448761 gi_def: Pseudomonas aeruginosa strain PAO1 AlgW (algW) gene, complete cds hsp_num: 1 from: 547 to: 600
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 1007802 to: 1007855
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 1157377 to: 1157430
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191757 to: 191810
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713248 to: 2713301
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 2315426 to: 2315479
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803602 to: 803655
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239138 to: 3239197
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 751937 to: 751990
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 5143971 to: 5144024
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 890825 to: 890878
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4980380 to: 4980433
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 532 to: 585
gi-nr: gi|109624723 gi_def: Haloquadratum walsbyi DSM 16790 complete genome hsp_num: 1 from: 1044703 to: 1044756
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 4836683 to: 4836736
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1345366 to: 1345419
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 266953 to: 267006
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 839906 to: 839959
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 3699943 to: 3700002
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 2 from: 4428866 to: 4428919
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 3383582 to: 3383638
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 3719439 to: 3719492
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 3 from: 2055227 to: 2055280
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1022249 to: 1022302
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 4721927 to: 4721980
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193397 to: 1193456
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 7894 to: 7947
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1080993 to: 1081052
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 1075665 to: 1075718
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343302 to: 1343355
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349393 to: 349446
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 3709297 to: 3709350
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190498 to: 190551
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194623 to: 194676
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163533 to: 163586
gi-nr: gi|41760 gi_def: Escherichia coli htrA gene for 51kD protein hsp_num: 1 from: 775 to: 825
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 1487673 to: 1487726
gi-nr: gi|146413 gi_def: E.coli htrA gene, complete cds hsp_num: 1 from: 775 to: 825
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 4919722 to: 4919775
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 5003528 to: 5003581
gi-nr: gi|156773154 gi_def: Uncultured bacterium clone LM0ACA3ZE01FM1 genomic sequence hsp_num: 1 from: 358 to: 417
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1909979 to: 1910038
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3680560 to: 3680613
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 2 from: 2768333 to: 2768392
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 437262 to: 437324
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3509212 to: 3509265
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 2632670 to: 2632729
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 3596988 to: 3597047
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 2 from: 3453729 to: 3453782
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1527907 to: 1527960
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391773 to: 391826
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3407578 to: 3407631
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3630588 to: 3630641
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579503 to: 4579556
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548948 to: 1549007
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 757472 to: 757525
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 2 from: 1767575 to: 1767634
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 1 from: 512 to: 565
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 432684 to: 432746
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 161995 to: 162048
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163413 to: 163466
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1081960 to: 1082022
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 643 to: 696
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2061 to: 2114
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1041 to: 1094
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2459 to: 2512
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1308673 to: 1308726
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696478 to: 696531
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754655 to: 754708
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 1 from: 1725721 to: 1725774
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211652 to: 2211705
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644174 to: 644227
gi-nr: gi|66934522 gi_def: Rhizobium etli strain 8C-3 plasmid clone REB02, partial sequence hsp_num: 1 from: 172643 to: 172696
gi-nr: gi|89213252 gi_def: Rhizobium etli CFN 42 plasmid symbiotic plasmid p42d, complete sequence hsp_num: 1 from: 25243 to: 25296
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 2168075 to: 2168128
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 43906 to: 43959
gi-nr: gi|39650002 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 11/16 hsp_num: 1 from: 151380 to: 151433
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 1930 to: 1983
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 688702 to: 688755
gi-nr: gi|33640689 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 4/7 hsp_num: 1 from: 230921 to: 230974
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 377 to: 415
gi-nr: gi|156147576 gi_def: Synthetic construct Bacillus anthracis clone FLH259079.01L BA3660 gene, complete sequence hsp_num: 2 from: 610 to: 669
gi-nr: gi|118415003 gi_def: Bacillus thuringiensis str. Al Hakam, complete genome hsp_num: 2 from: 3439607 to: 3439666
gi-nr: gi|49328240 gi_def: Bacillus thuringiensis serovar konkukian str. 97-27, complete genome hsp_num: 2 from: 3438136 to: 3438195
gi-nr: gi|50082967 gi_def: Bacillus anthracis str. 'Ames Ancestor', complete genome hsp_num: 2 from: 3368536 to: 3368595
gi-nr: gi|49176966 gi_def: Bacillus anthracis str. Sterne, complete genome hsp_num: 2 from: 3369103 to: 3369162
gi-nr: gi|51973633 gi_def: Bacillus cereus E33L, complete genome hsp_num: 2 from: 3441330 to: 3441389
gi-nr: gi|30260185 gi_def: Bacillus anthracis str. Ames, complete genome hsp_num: 2 from: 3368409 to: 3368468
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 360506 to: 360559
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 2 from: 1472427 to: 1472480
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 1411177 to: 1411230
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910394 to: 2910447
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 1 from: 712867 to: 712920
gi-nr: gi|110816552 gi_def: Rhodococcus sp. RHA1, complete genome hsp_num: 2 from: 6050317 to: 6050370
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40635 to: 40688
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 585207 to: 585260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 2 from: 647478 to: 647531
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2244804 to: 2244857
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 2 from: 2777068 to: 2777121
gi-nr: gi|33577019 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 12/16 hsp_num: 1 from: 142954 to: 143007
gi-nr: gi|33574176 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 11/14 hsp_num: 1 from: 79447 to: 79500
gi-nr: gi|33572656 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 8/12 hsp_num: 1 from: 146090 to: 146143
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 102893 to: 102946
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 91940 to: 91993
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 105627 to: 105680
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 105287 to: 105340
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 106823 to: 106876
gi-nr: gi|115465520 gi_def: Oryza sativa (japonica cultivar-group) Os05g0568900 (Os05g0568900) mRNA, complete cds hsp_num: 1 from: 695 to: 751
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 97358 to: 97411
gi-nr: gi|75756008 gi_def: Taraxacum officinale TO102-1 (To102-1) mRNA, partial cds hsp_num: 1 from: 175 to: 231
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 1 from: 4591706 to: 4591759
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 2 from: 4626241 to: 4626294
gi-nr: gi|86565586 gi_def: Frankia sp. CcI3, complete genome hsp_num: 3 from: 87405 to: 87458
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 88981 to: 89034
gi-nr: gi|33633502 gi_def: Prochlorococcus marinus MED4 complete genome; segment 1/5 hsp_num: 1 from: 95680 to: 95733
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226831 to: 226890
gi-nr: gi|37990249 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:J013152N11, full insert sequence hsp_num: 1 from: 724 to: 780
gi-nr: gi|32971468 gi_def: Oryza sativa (japonica cultivar-group) cDNA clone:006-307-E05, full insert sequence hsp_num: 1 from: 715 to: 771
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 2481610 to: 2481663
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 2 from: 5767229 to: 5767282
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 2 from: 808387 to: 808440
gi-nr: gi|111147037 gi_def: Frankia alni str. ACN14A chromosome, complete sequence hsp_num: 1 from: 6655201 to: 6655254
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5482462 to: 5482515
gi-nr: gi|50839098 gi_def: Propionibacterium acnes KPA171202, complete genome hsp_num: 1 from: 2506736 to: 2506789
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 1 from: 305282 to: 305335
gi-nr: gi|33574803 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 14/14 hsp_num: 1 from: 97653 to: 97706
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 142 to: 180
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5202198 to: 5202251
gi-nr: gi|118163506 gi_def: Mycobacterium avium 104, complete genome hsp_num: 1 from: 1040982 to: 1041035
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 466 to: 519
gi-nr: gi|54013472 gi_def: Nocardia farcinica IFM 10152 DNA, complete genome hsp_num: 1 from: 5178171 to: 5178224
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 951622 to: 951675
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035432 to: 1035488
gi-nr: gi|145213092 gi_def: Mycobacterium gilvum PYR-GCK, complete genome hsp_num: 1 from: 1970063 to: 1970116
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 1 from: 4914770 to: 4914823
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 5178774 to: 5178827
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 1 from: 4605600 to: 4605653
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 1 from: 4566395 to: 4566448
gi-nr: gi|78097479 gi_def: Culex pipiens quinquefasciatus, clone Culex pipiens quinquefasciatus-3940136D9, complete sequence hsp_num: 1 from: 101899 to: 101952
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501549 to: 501602
gi-nr: gi|32444740 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 12/24 hsp_num: 1 from: 104973 to: 105026
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 232 to: 285
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583816 to: 1583869
gi-nr: gi|341248 gi_def: E. coli mdh gene encoding malate dehydrogenase, complete cds hsp_num: 1 from: 2189 to: 2242
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119201 to: 1119254
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1103633 to: 1103686
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1101172 to: 1101225
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1130353 to: 1130406
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5567050 to: 5567103
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1099903 to: 1099956
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 121370 to: 121423
gi-nr: gi|23428392 gi_def: Xanthomonas oryzae pv. oryzae KACC10331 BAC clone 4K15, complete sequence hsp_num: 1 from: 47185 to: 47238
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 296293 to: 296346
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 4670949 to: 4671002
gi-nr: gi|21110386 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 425 of 469 of the complete genome hsp_num: 1 from: 1726 to: 1779
gi-nr: gi|21115140 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 418 of 460 of the complete genome hsp_num: 1 from: 9686 to: 9739
gi-nr: gi|68262661 gi_def: Corynebacterium jeikeium K411 complete genome hsp_num: 1 from: 1803467 to: 1803526
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 4702221 to: 4702274
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 66077 to: 66130
gi-nr: gi|31617663 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 4/14 hsp_num: 1 from: 113315 to: 113368
gi-nr: gi|28204652 gi_def: Clostridium tetani E88, complete genome hsp_num: 1 from: 903288 to: 903341
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 54628 to: 54681
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 294716 to: 294769


Query-DNA-Entry-Section

Query-DNA-Def dare_031|beg|835|length|130|forward|gi
Query_DNA-Sequence
ttaatctagcttaacaccaatTatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgattagaTttttaaaacagtTgcctacaatatcttcaagatctttagtagattttatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_033|beg|443|length|110|forward|gi
Query_DNA-Sequence
tagtctaactttatttctaaacttaagaggtatctctggaattttaatagtccattgatttaatgattgaaaatatagacctgttccaccaactaaaattggaatttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_034|beg|1399|length|104|forward|gi
Query_DNA-Sequence
tgctcctctaggttcatctaatttttcaacttcaTgcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcTaccaaattctat

Coding-DNA-Entry-Section

Coding-DNA
aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt
Protein-Sequence
MVETKRGWLGVRIQVVSEEIA
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5432 to: 5488
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448

Coding-DNA
aatttcttcagaaactacctgaattctaacacccagccatcctcttttagtt
Protein-Sequence
MVETKRGWLGVRIQVVSEEIA
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 5432 to: 5488
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866271 to: 1866327
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065263 to: 2065334
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195407 to: 195478
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402436 to: 3402492
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909617 to: 2909673
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 1211068 to: 1211124
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418747 to: 2418821
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713611 to: 3713685
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608803 to: 3608877
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396071 to: 1396127
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321176 to: 2321250
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887440 to: 1887496
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6322689 to: 6322763
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5756959 to: 5757033
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057213 to: 2057269
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209729 to: 3209785
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2555911 to: 2555964
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904847 to: 904903
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117879 to: 2117935
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085392 to: 2085448


Query-DNA-Entry-Section

Query-DNA-Def dare_035|beg|275|length|111|forward|gi
Query_DNA-Sequence
agatttagtcttagctaaccaatcatacatagatatatttgtataagatttaatctcataaTgctcttatggatctttgagtatcattttTggatcaaatttgTtctttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_036|beg|2480|length|133|forward|gi
Query_DNA-Sequence
gaattcactgtcagggtgataaaattaaagatTgtctgtccaccaattaaagcagtttcataggcttgcatcgcTtctgtagaaagcaaaaaattctgcatctcttccaaaaggcttctgcaaagatcttatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_043|beg|1462|length|127|forward|gi
Query_DNA-Sequence
aacacccagccatcctcttttagttttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagagccTacctttacccaaaattgctgtgt

Coding-DNA-Entry-Section

Coding-DNA
tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag
Protein-Sequence
GSIGIGFSIPSNDAKRVVNQLIEFGE
Hit-Information Section
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912
gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282

Coding-DNA
tcaccaaattctatcaattgatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagag
Protein-Sequence
GSIGIGFSIPSNDAKRVVNQLIEFGE
Hit-Information Section
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001933 to: 2002010
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6280 to: 6357
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 1 from: 574635 to: 574712
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204870 to: 2204944
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 3993008 to: 3993085
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057267 to: 2057344
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350586 to: 1350663
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 4276323 to: 4276400
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 3711539 to: 3711616
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 3425042 to: 3425119
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 3664033 to: 3664110
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 3331984 to: 3332061
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 3483054 to: 3483131
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866325 to: 1866402
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 3591121 to: 3591198
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 3369327 to: 3369404
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 3381309 to: 3381386
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 3379476 to: 3379553
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8098 to: 8175
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 3804935 to: 3805012
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 3359409 to: 3359486
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163737 to: 163814
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 4116690 to: 4116767
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322686 to: 3322763
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355231 to: 3355308
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470869 to: 3470946
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 1 from: 162199 to: 162276
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 1 from: 847 to: 924
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 1 from: 1245 to: 1322
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 4183907 to: 4183984
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 3165473 to: 3165550
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 3160945 to: 3161022
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 3553147 to: 3553224
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976835 to: 3976912
gi-nr: gi|50950407 gi_def: Leifsonia xyli subsp. xyli str. CTCB07, complete genome hsp_num: 1 from: 1421217 to: 1421282


Query-DNA-Entry-Section

Query-DNA-Def dare_044|beg|2597|length|122|forward|gi
Query_DNA-Sequence
aaagatcttatttctttcaccatcaccttgaccccttcatTatttcagattctttattagcatttgctaaaattacagaaacatctttgtctgcagttgaagtaattgtaaccgccatctct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_045|beg|1646|length|133|forward|gi
Query_DNA-Sequence
attgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatcaccaa

Coding-DNA-Entry-Section

Coding-DNA
ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca
Protein-Sequence
GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS
Hit-Information Section
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383
gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066
gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057
gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972
gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462
gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297

Coding-DNA
ttgatgcatcagtttgaatgtaatcttTcataacgagcagtccgattgatctatttcttgctgatattattcctgcagtaaccgttcctcctaagccaaagggattgccgattgcgataacccaatca
Protein-Sequence
GDWVIAIGNPFGLGGTVTAGIISARNRSIGLLVMKDYIQTDAS
Hit-Information Section
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866490 to: 1866618
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1340233 to: 1340361
gi-nr: gi|39651254 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 15/16 hsp_num: 1 from: 266491 to: 266616
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038100 to: 1038228
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 2 from: 2205071 to: 2205160
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 3917633 to: 3917758
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 4 from: 8194156 to: 8194239
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 3 from: 29009 to: 29092
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 3 from: 3171485 to: 3171568
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 2978178 to: 2978264
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617875 to: 2617967
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1347082 to: 1347171
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 2 from: 634434 to: 634517
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 170796 to: 170885
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552024 to: 3552113
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360556 to: 2360645
gi-nr: gi|19172958 gi_def: Caulobacter crescentus CB15 complete genome hsp_num: 1 from: 2973541 to: 2973627
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 2535203 to: 2535286
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 2 from: 576890 to: 576973
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 3 from: 266938 to: 267021
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 1933539 to: 1933622
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1934465 to: 1934554
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 852871 to: 852954
gi-nr: gi|32443133 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 3/24 hsp_num: 1 from: 79063 to: 79146
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 3 from: 3267177 to: 3267260
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 647463 to: 647552
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 2777053 to: 2777142
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904559 to: 904645
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 974138 to: 974227
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 2 from: 1915 to: 1998
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091876 to: 1091947
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2714644 to: 2714727
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118137 to: 2118223
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 3619693 to: 3619782
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 3239123 to: 3239212
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 3 from: 1159259 to: 1159342
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835629 to: 1835715
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 3841979 to: 3842068
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 2 from: 927038 to: 927130
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085650 to: 2085736
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 970359 to: 970442
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 273800 to: 273883
gi-nr: gi|33236669 gi_def: Chlamydophila pneumoniae TW-183, section 4 of 4 of the complete genome hsp_num: 1 from: 219056 to: 219139
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 946788 to: 946871
gi-nr: gi|27904416 gi_def: Buchnera aphidicola str. Bp (Baizongia pistaciae), complete genome hsp_num: 1 from: 246517 to: 246600
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 1124544 to: 1124627
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 967621 to: 967704
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 1120949 to: 1121032
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 2 from: 696463 to: 696546
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 881010 to: 881093
gi-nr: gi|33638930 gi_def: Synechococcus sp. WH8102 complete genome; segment 5/7 hsp_num: 1 from: 89978 to: 90061
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 1309470 to: 1309553
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888582 to: 888665
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2971884 to: 2971967
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 3 from: 3712738 to: 3712818
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 3 from: 3426241 to: 3426321
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 3095240 to: 3095323
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557300 to: 3557383
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 208226 to: 208309
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3992789 to: 3992872
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 3 from: 3994196 to: 3994276
gi-nr: gi|148508398 gi_def: Salmonella enteritidis serine protease heat shock protein gene, complete cds hsp_num: 1 from: 562 to: 645
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 798144 to: 798227
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976616 to: 3976699
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 3 from: 3978036 to: 3978116
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 3939750 to: 3939833
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 187239 to: 187322
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 3 from: 3665232 to: 3665312
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 172772 to: 172855
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 3 from: 3333183 to: 3333263
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 186668 to: 186751
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 187263 to: 187346
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 3 from: 3592320 to: 3592400
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 173101 to: 173184
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 3 from: 3370506 to: 3370586
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 3 from: 3382508 to: 3382588
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 181442 to: 181525
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 3 from: 3380675 to: 3380755
gi-nr: gi|16418705 gi_def: Salmonella typhimurium LT2, section 12 of 220 of the complete genome hsp_num: 1 from: 7927 to: 8010
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 191781 to: 191864
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 427016 to: 427099
gi-nr: gi|47929 gi_def: S.typhimurium gene for serine protease heat shock protein hsp_num: 1 from: 956 to: 1039
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 172588 to: 172671
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 3 from: 3360588 to: 3360668
gi-nr: gi|16501283 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 1/20 hsp_num: 1 from: 242061 to: 242144
gi-nr: gi|18621131 gi_def: Klebsiella pneumoniae htrA gene hsp_num: 1 from: 941 to: 1024
gi-nr: gi|62945638 gi_def: Uncultured bacterium zdt-25h14 clone zdt-25h14, complete sequence hsp_num: 1 from: 16864 to: 16950
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 1428566 to: 1428649
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 185641 to: 185724
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 3 from: 4117889 to: 4117969
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 249325 to: 249408
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 242052 to: 242135
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 241166 to: 241249
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 185642 to: 185725
gi-nr: gi|1552727 gi_def: Escherichia coli chromosome minutes 4-6 hsp_num: 1 from: 12517 to: 12600
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 3 from: 3166672 to: 3166752
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 167471 to: 167554
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 3 from: 3159743 to: 3159823
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 196362 to: 196445
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 3 from: 3554346 to: 3554426
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 1 from: 559 to: 642
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 1 from: 338 to: 373
gi-nr: gi|1871783 gi_def: R.prowazekii genomic DNA fragment (clone A471F) hsp_num: 2 from: 377 to: 427
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 871530 to: 871613
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 842036 to: 842119
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 829843 to: 829926
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 346148 to: 346231
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 4276963 to: 4277046
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 3913590 to: 3913673
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3651880 to: 3651963
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325611 to: 325694
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 806730 to: 806813
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 805270 to: 805353
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 4338777 to: 4338860
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 4011465 to: 4011548
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 796519 to: 796602
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 795059 to: 795142
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 3903460 to: 3903543
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 3904920 to: 3905003
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 573678 to: 573761
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 4730824 to: 4730907
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 439247 to: 439330
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 1 from: 493 to: 576
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 4087599 to: 4087682
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 4089059 to: 4089142
gi-nr: gi|22122029 gi_def: Photobacterium damselae subsp. piscicida genes for DegQ serine protease, DegS serine protease, complete cds hsp_num: 1 from: 1104 to: 1187
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 2 from: 7250081 to: 7250173
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 253505 to: 253588
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 252716 to: 252799
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2502819 to: 2502902
gi-nr: gi|4321102 gi_def: Buchnera aphidicola succinyl-diaminopimelate aminotransferase (dapD) gene, partial cds; periplasmic serine protease (htrA), hypothetical protein, acetohydroxy acid synthase large subunit (ilvI), acetohydroxy acid synthase small subunit (ilvH), hypothetical protein, cell division protein (ftsL), and penicillin binding protein 3 precursor (ftsI) genes, complete cds; and meso-diaminopimelate adding enzyme (murE) gene, partial cds hsp_num: 1 from: 1356 to: 1439
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3735516 to: 3735599
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 531126 to: 531209
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 529714 to: 529794
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3379724 to: 3379807
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 369803 to: 369886
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 367680 to: 367760
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 4090359 to: 4090442
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 4091773 to: 4091853
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3775142 to: 3775225
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3979316 to: 3979399
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3981442 to: 3981522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 315998 to: 316081
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 4350814 to: 4350897
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 4352940 to: 4353020
gi-nr: gi|109694929 gi_def: Synthetic construct Yersinia pestis clone FLH0127327.01X htrA gene, complete sequence hsp_num: 1 from: 574 to: 657
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 644159 to: 644242
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 3207590 to: 3207673
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 4189167 to: 4189250
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 4187044 to: 4187124
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 832285 to: 832368
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 3935883 to: 3935966
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 3938009 to: 3938089
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 903332 to: 903415
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 149080 to: 149163
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 151206 to: 151286
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 615251 to: 615334
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 577174 to: 577257
gi-nr: gi|74474902 gi_def: Edwardsiella tarda gene for antigenic protein Et 49, complete cds hsp_num: 1 from: 773 to: 856
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 900902 to: 900985
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 4180880 to: 4180963
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 4182295 to: 4182375
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 1 from: 103 to: 138
gi-nr: gi|2073468 gi_def: R.prowazekii gene encoding hypothetical 47 kDa protein hsp_num: 2 from: 142 to: 192
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1730815 to: 1730898
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 2315411 to: 2315491
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 53590 to: 53673
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 2 from: 7720610 to: 7720693
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 3 from: 2481595 to: 2481678
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 501534 to: 501617
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 1119186 to: 1119269
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1264269 to: 1264304
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 2 from: 1264209 to: 1264265
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 4824405 to: 4824488
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 2713233 to: 2713316
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 517 to: 600
gi-nr: gi|36958823 gi_def: Rhizobium sp. NGR234 megaplasmid 2 contig 1, complete sequence hsp_num: 1 from: 259713 to: 259793
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 1931299 to: 1931382
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 1552300 to: 1552383
gi-nr: gi|21107474 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 141 of 469 of the complete genome hsp_num: 1 from: 6983 to: 7066
gi-nr: gi|21112314 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 134 of 460 of the complete genome hsp_num: 1 from: 5974 to: 6057
gi-nr: gi|18496603 gi_def: Xanthomonas campestris pv. campestris anti-sigma factor RseA (rseA) and protease MucD (mucD) genes, complete cds hsp_num: 1 from: 1577 to: 1660
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 3557487 to: 3557570
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 1343287 to: 1343370
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190483 to: 190566
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 194608 to: 194688
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 1583801 to: 1583884
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 3 from: 886913 to: 886993
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 1953324 to: 1953407
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 296278 to: 296361
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 4579488 to: 4579571
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 163398 to: 163478
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 294701 to: 294784
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 2046 to: 2126
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 2444 to: 2524
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 4224481 to: 4224567
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 40620 to: 40703
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 2687723 to: 2687806
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1238477 to: 1238512
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 3 from: 3888468 to: 3888554
gi-nr: gi|12057215 gi_def: Halobacterium sp. NRC-1, complete genome hsp_num: 1 from: 191742 to: 191828
gi-nr: gi|15619207 gi_def: Rickettsia conorii str. Malish 7, section 15 of 114 of the complete genome hsp_num: 1 from: 4773 to: 4808
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 147995 to: 148030
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 1 from: 147455 to: 147490
gi-nr: gi|3860572 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 hsp_num: 2 from: 147494 to: 147544
gi-nr: gi|133909243 gi_def: Saccharopolyspora erythraea NRRL2338 complete genome hsp_num: 1 from: 857895 to: 857972
gi-nr: gi|125827955 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, (LOC795811), mRNA hsp_num: 2 from: 303 to: 329
gi-nr: gi|24413879 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 19/29 hsp_num: 1 from: 226816 to: 226902
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 1 from: 2910376 to: 2910462
gi-nr: gi|125827892 gi_def: PREDICTED: Danio rerio similar to HtrA serine peptidase 2, transcript variant 3 (LOC560031), mRNA hsp_num: 2 from: 289 to: 315
gi-nr: gi|109695165 gi_def: Synthetic construct Yersinia pestis clone FLH0129517.01X degS gene, complete sequence hsp_num: 1 from: 451 to: 531
gi-nr: gi|26986195 gi_def: Paenibacillus larvae partial palk gene for larvakinase hsp_num: 1 from: 217 to: 297


Query-DNA-Entry-Section

Query-DNA-Def dare_048|beg|1081|length|128|forward|gi
Query_DNA-Sequence
atcttcatcattcaatggtcttacaattatttttaaagatttaatttcagaaattttcaggtgtttcttctttagtttcttttttttctactttaaaatccctctgaagtttcaagtcttcctagttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_049|beg|1380|length|127|forward|gi
Query_DNA-Sequence
ctgcaacactagTcaactaatgctcctctaggttcatctaatttttcTaacttcagcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa

Coding-DNA-Entry-Section

Coding-DNA
gcaatttTcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaa
Protein-Sequence
LIEFGETKRGWLGVRIQVVSEENC*S
Hit-Information Section
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69154 to: 69219
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6232 to: 6297
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2001885 to: 2001950
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866277 to: 1866342
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065284 to: 2065349
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195428 to: 195493
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057219 to: 2057284
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396056 to: 1396121
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209735 to: 3209800
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887425 to: 1887490
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402442 to: 3402507
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904832 to: 904897
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117885 to: 2117950
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085398 to: 2085463
gi-nr: gi|2094849 gi_def: R.capsulatus fdxE gene hsp_num: 1 from: 1102 to: 1152


Query-DNA-Entry-Section

Query-DNA-Def dare_052|beg|57|length|110|forward|gi
Query_DNA-Sequence
tccaaggtaatttcatatttagatactgtgtcaattcggcaatcccaattaccttgtttacactctgatctttttaatttttTagtttaagaaattttttaaacttcaga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_053|beg|2036|length|110|forward|gi
Query_DNA-Sequence
aacatatcttcaaaaggtgatcctgggggaaactgaaaaccaggaaatggTatttagaatttgtagtaactgttgtcgttgtagaaatgtttacaacagatggcattaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_054|beg|1446|length|104|forward|gi
Query_DNA-Sequence
aaactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttTgcatcgttcatggtattggaaaaacc

Coding-DNA-Entry-Section

Coding-DNA
aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct
Protein-Sequence
MQKRVVNQLIEFGETKRGWLGVRIQVV
Hit-Information Section
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112

Coding-DNA
aactacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactct
Protein-Sequence
MQKRVVNQLIEFGETKRGWLGVRIQVV
Hit-Information Section
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057228 to: 2057299
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904817 to: 904888
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2117894 to: 2117965
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835887 to: 1835958
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085407 to: 2085478
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209744 to: 3209812
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1350547 to: 1350618
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1396041 to: 1396112


Query-DNA-Entry-Section

Query-DNA-Def dare_055|beg|1556|length|113|forward|gi
Query_DNA-Sequence
atagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgagtttattgatgcatcagtttgTaatg

Coding-DNA-Entry-Section

Coding-DNA
tagagccacctttacccaaaattgctgtgttaattccaattacatcaccattcatatcaaataaaggtccgcctgagttttcctgag
Protein-Sequence
TQENSGGPLFDMNGDVIGINTAILGKGGS
Hit-Information Section
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176455 to: 8176526
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 2 from: 3517066 to: 3517137
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 5328805 to: 5328876
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 4 from: 1070315 to: 1070380
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5482594 to: 5482665
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887290 to: 1887364
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355803 to: 1355877
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349101 to: 1349175
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8706 to: 8780
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367196 to: 1367270
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364346 to: 1364420
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395921 to: 1395995
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316866 to: 2316928
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 4 from: 1040311 to: 1040373
gi-nr: gi|109695169 gi_def: Synthetic construct Yersinia pestis clone FLH0129645.01X degQ gene, complete sequence hsp_num: 1 from: 661 to: 735
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065410 to: 2065484
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195554 to: 195628
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402568 to: 3402642
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6358 to: 6432
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909749 to: 2909823
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002011 to: 2002085
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556043 to: 2556117
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2989359 to: 2989430
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 2 from: 365565 to: 365636
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69280 to: 69354
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 6049720 to: 6049797
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9948 to: 10007
gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 1734087 to: 1734161
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 688 to: 747
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012230 to: 1012289
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798982 to: 799041
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 3227725 to: 3227799
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515190 to: 3515261
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2294445 to: 2294519
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 5 from: 2987759 to: 2987821
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 1 from: 8023 to: 8097
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1210084 to: 1210155
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 2 from: 2455093 to: 2455155
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16333 to: 16398
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 888447 to: 888521
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 4958967 to: 4959038
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 2 from: 1044380 to: 1044451
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1910105 to: 1910176
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1548810 to: 1548881
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 1 from: 163662 to: 163736
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 3322611 to: 3322685
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 3355156 to: 3355230
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 3470794 to: 3470868
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 391623 to: 391697
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 2 from: 2029969 to: 2030031
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 349243 to: 349317
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 190627 to: 190701
gi-nr: gi|2062623 gi_def: Mycobacterium tuberculosis sigma factor SigE (sigE) and HtrA (htrA) genes, complete cds hsp_num: 1 from: 3088 to: 3144
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1193523 to: 1193585
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1081119 to: 1081181
gi-nr: gi|32447713 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 22/24 hsp_num: 1 from: 37110 to: 37187
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 691053 to: 691112
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7720763 to: 7720825
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 5 from: 2481466 to: 2481525
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 6 from: 5421057 to: 5421116
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 7 from: 5699996 to: 5700058
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 3 from: 1234329 to: 1234391
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 3 from: 2622356 to: 2622418
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 3858651 to: 3858722
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778195 to: 3778266
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 1127546 to: 1127617
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 92570 to: 92641
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4649671 to: 4649742
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 430500 to: 430559
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 1971130 to: 1971189
gi-nr: gi|145557411 gi_def: Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence hsp_num: 2 from: 301701 to: 301754
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1367253 to: 1367315
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1354728 to: 1354790
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1389165 to: 1389227
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 530991 to: 531065
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 369668 to: 369742
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3979460 to: 3979534
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 4350958 to: 4351032
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 4189032 to: 4189106
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 3936027 to: 3936101
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 149224 to: 149298
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 4181024 to: 4181098
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 688840 to: 688905
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 4 from: 3446891 to: 3446950
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 1 from: 27894 to: 27953
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 1 from: 27362 to: 27421
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 1 from: 332508 to: 332570
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 4 from: 1167588 to: 1167650
gi-nr: gi|32448029 gi_def: Rhodopirellula baltica SH 1 complete genome; segment 23/24 hsp_num: 1 from: 213562 to: 213627
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 1 from: 600903 to: 600965
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035561 to: 1035623
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4315831 to: 4315884
gi-nr: gi|157313474 gi_def: Thermotoga lettingae TMO, complete genome hsp_num: 1 from: 426172 to: 426234
gi-nr: gi|149792434 gi_def: Thermosipho melanesiensis BI429, complete genome hsp_num: 1 from: 1781964 to: 1782026
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3653436 to: 3653492
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170642 to: 5170698
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 4 from: 4084087 to: 4084146
gi-nr: gi|145358489 gi_def: Arabidopsis thaliana serine-type peptidase/ trypsin (AT5G27660) mRNA, complete cds hsp_num: 1 from: 902 to: 952
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 2 from: 4238430 to: 4238486
gi-nr: gi|126232413 gi_def: Mycobacterium sp. JLS, complete genome hsp_num: 3 from: 922705 to: 922761
gi-nr: gi|125860746 gi_def: Methanoculleus marisnigri JR1, complete genome hsp_num: 1 from: 1350874 to: 1350936
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 1 from: 4829762 to: 4829818
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 2 from: 4292609 to: 4292665
gi-nr: gi|119692146 gi_def: Mycobacterium sp. KMS, complete genome hsp_num: 3 from: 944725 to: 944781
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 2 from: 4258127 to: 4258183
gi-nr: gi|108767400 gi_def: Mycobacterium sp. MCS, complete genome hsp_num: 3 from: 938918 to: 938974
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 769134 to: 769193
gi-nr: gi|699111 gi_def: Mycobacterium leprae cosmid B1756 hsp_num: 1 from: 22206 to: 22262
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 3 from: 1091738 to: 1091791
gi-nr: gi|145362659 gi_def: Arabidopsis thaliana DEGP8 (DEGP PROTEASE 8); serine-type peptidase/ trypsin (DEGP8) mRNA, complete cds hsp_num: 1 from: 957 to: 1016
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 3 from: 1071559 to: 1071612
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 2 from: 1054235 to: 1054294
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 2 from: 566585 to: 566644
gi-nr: gi|154152641 gi_def: Fervidobacterium nodosum Rt17-B1, complete genome hsp_num: 1 from: 1103306 to: 1103368
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 1 from: 4965950 to: 4966009
gi-nr: gi|148878541 gi_def: Streptomyces avermitilis MA-4680 genomic DNA, complete genome hsp_num: 2 from: 5178264 to: 5178323
gi-nr: gi|148719718 gi_def: Mycobacterium tuberculosis F11, complete genome hsp_num: 1 from: 1370796 to: 1370852
gi-nr: gi|148503909 gi_def: Mycobacterium tuberculosis H37Ra, complete genome hsp_num: 1 from: 1368340 to: 1368396
gi-nr: gi|121491530 gi_def: Mycobacterium bovis BCG Pasteur 1173P2, complete genome hsp_num: 1 from: 1396752 to: 1396808
gi-nr: gi|118568029 gi_def: Mycobacterium ulcerans Agy99, complete genome hsp_num: 1 from: 5011660 to: 5011716
gi-nr: gi|50952454 gi_def: Mycobacterium tuberculosis CDC1551, complete genome hsp_num: 1 from: 1366518 to: 1366574
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 4 from: 5412814 to: 5412873
gi-nr: gi|41353619 gi_def: Mycobacterium tuberculosis H37Rv complete genome; segment 4/13 hsp_num: 1 from: 333243 to: 333299
gi-nr: gi|31617962 gi_def: Mycobacterium bovis subsp. bovis AF2122/97 complete genome; segment 5/14 hsp_num: 1 from: 53674 to: 53730
gi-nr: gi|24427855 gi_def: Streptomyces coelicolor A3(2) complete genome; segment 16/29 hsp_num: 1 from: 43612 to: 43671
gi-nr: gi|13092922 gi_def: Mycobacterium leprae strain TN complete genome; segment 4/10 hsp_num: 1 from: 241942 to: 241998
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 241283 to: 241342
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 2 from: 1583672 to: 1583731
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 1 from: 2873145 to: 2873201
gi-nr: gi|41400296 gi_def: Mycobacterium avium subsp. paratuberculosis str. k10, complete genome hsp_num: 2 from: 426994 to: 427047
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 526 to: 579
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1039 to: 1092
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 696340 to: 696399
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 1 from: 1123 to: 1176
gi-nr: gi|123962000 gi_def: Prochlorococcus marinus str. MIT 9303, complete genome hsp_num: 1 from: 754517 to: 754576
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 988 to: 1041
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1084 to: 1137
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 1725853 to: 1725912
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 1006 to: 1059
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 926924 to: 926983
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 718 to: 771
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 998 to: 1051
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 2 from: 338250 to: 338312


Query-DNA-Entry-Section

Query-DNA-Def dare_056|beg|1114|length|141|forward|gi
Query_DNA-Sequence
taaagatttaatttcagaaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTtctctcttttatttctccagattttaacatct

Coding-DNA-Entry-Section

Coding-DNA
aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt
Protein-Sequence
QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222

Coding-DNA
aaaatttcaggtgtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaaTt
Protein-Sequence
QKISGVSSLVSFFSTLKSSEVSSLPSLIFFVI
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 5130 to: 5222


Query-DNA-Entry-Section

Query-DNA-Def dare_057|beg|769|length|112|forward|gi
Query_DNA-Sequence
caaaatttatttacctgatgcTagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagcttaacaccaatataTtcttctttggttttgattatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_058|beg|2464|length|120|forward|gi
Query_DNA-Sequence
taccTaaaaaatttaaagaattcactgtcaggtgataaaattTaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcgctctgtagaaagcaaaaaattctgcatctct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_059|beg|2772|length|139|forward|gi
Query_DNA-Sequence
ctataaattTgcatcactgtttgcttgtggaaggtccgctcttttaattTctaacatcTtactattttaattccaaaactttcagcttcagtattacaccttcttgtattaaagccatttgtttagttctgtcttttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_061|beg|1861|length|115|forward|gi
Query_DNA-Sequence
gggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttgaataacatgattgttagtgattacaattccactctcttc

Coding-DNA-Entry-Section

Coding-DNA
ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga
Protein-Sequence
DQHQQPSLYILYHHQLELKYLLHF*I
Hit-Information Section

Coding-DNA
ggatcagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaactaaaatatcttctgcaTttttga
Protein-Sequence
DQHQQPSLYILYHHQLELKYLLHF*I
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_062|beg|2286|length|121|forward|gi
Query_DNA-Sequence
actgcaaaaattaacccaccacttcttaattgtTgaatcttttatcatctccattttttttaacaTtactttttcatttttgatggaaataaggcatataaaattccttctataaaaagaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_064|beg|755|length|122|forward|gi
Query_DNA-Sequence
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgcttgtccattattaatctagcttaacaccaatatatcttctttggttttgat

Coding-DNA-Entry-Section

Coding-DNA
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt
Protein-Sequence
TSRSKIILISGPTASGKSNFAVKIA
Hit-Information Section
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167
gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855

Coding-DNA
tgcaatcttaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggaTctgctt
Protein-Sequence
TSRSKIILISGPTASGKSNFAVKIA
Hit-Information Section
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2398998 to: 2399066
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193204 to: 193260
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3852887 to: 3852943
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2062917 to: 2062973
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 947249 to: 947308
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3400111 to: 3400167
gi-nr: gi|91203347 gi_def: Kuenenia stuttgartiensis genome fragment KUST_C (3 of 5) hsp_num: 1 from: 542218 to: 542277
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2907799 to: 2907855


Query-DNA-Entry-Section

Query-DNA-Def dare_065|beg|722|length|117|forward|gi
Query_DNA-Sequence
gtcggcattgatgattttccttcaatttttttgcaatcttaacagcaaaatttgatttaacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_066|beg|683|length|124|forward|gi
Query_DNA-Sequence
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaaatt

Coding-DNA-Entry-Section

Coding-DNA
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa
Protein-Sequence
ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA
Hit-Information Section
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 2062845 to: 2062880
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766

Coding-DNA
tgcagttaatatttttaattttttgtaaacctgcaTtactgtcggcattgatgatttctccttcaattttttttgcaatttaacagcaaaatttgatttacctgatgcagtcggtcctgaa
Protein-Sequence
ISGPTASGKSNFAVKLQKKLKEKSSMPTVMQVYKKLKILTA
Hit-Information Section
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 193198 to: 193254
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 2062845 to: 2062880
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 2565731 to: 2565766


Query-DNA-Entry-Section

Query-DNA-Def dare_069|beg|2328|length|127|forward|gi
Query_DNA-Sequence
atcatctccattttttttaacatacttttcatttttgatggaaataaggcatataaaattccttctataaaaaagaaaaagtccaaaagctataattagctctttcattttttagattaattttggt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_071|beg|2837|length|121|forward|gi
Query_DNA-Sequence
aattccaaaactttcacttcagtaTtttacTaccttcttgtatttaaagccatttgtttagttctgtcttttgaaagtaaagtttgtaattcttgctgacctagtacatttctcagtcttg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_072|beg|154|length|120|forward|gi
Query_DNA-Sequence
ttttaacttcagaaatggctccattaTtttagcatgctagaagttcttaaattaattttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_073|beg|167|length|138|forward|gi
Query_DNA-Sequence
aatggctccattatttagcatgctagaagttcttaaattaattttttcaacaaTgcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaatcataca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_074|beg|1887|length|128|forward|gi
Query_DNA-Sequence
tatattctttatcaccatcaactcgaactaaaatatcttcTtgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttccttg

Coding-DNA-Entry-Section

Coding-DNA
agtgattacaattTccactctcttctattataaatcctgaaccaagtgcagcagacttcct
Protein-Sequence
RKSAALGSGFIIEESGNCNH*Q
Hit-Information Section
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835395 to: 1835442
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1209706 to: 1209753
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563083 to: 1563130
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165333 to: 7165380


Query-DNA-Entry-Section

Query-DNA-Def dare_076|beg|1506|length|120|forward|gi
Query_DNA-Sequence
gatttacaactctttttgcatcgttcgatggTtattgaaaaacctatccccTatagagccacctttacccaaaattgctgtgttaattccaattacatcaccattatatcaaataaaggt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_077|beg|74|length|117|forward|gi
Query_DNA-Sequence
atttagatactgtgtcaattcggcaatTcccaattaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatTggctccattatttagcatg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_078|beg|1251|length|129|forward|gi
Query_DNA-Sequence
ctacagttttaccaacttctgtttgtgcaacaattattggtaattctttcatcttttaatcttagtgttattaaaTctctaataTtTaatgtctcctgctttaattccgctttgtcagatgggctattt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_081|beg|2109|length|129|forward|gi
Query_DNA-Sequence
tcgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaatgaagtggtgcgtctttttgcaaacccttTgtgatgcaaactttattgTcaaaaaaataataaataattttttaat

Coding-DNA-Entry-Section

Coding-DNA
cgttgtagaagtttacaacagatggcattaatttttctgccagatccgcaaat
Protein-Sequence
FICGSGRKINAICCKLLQR
Hit-Information Section
gi-nr: gi|18997370 gi_def: Homo sapiens chromosome 1 clone RP3-445O10, complete sequence hsp_num: 2 from: 136366 to: 136413


Query-DNA-Entry-Section

Query-DNA-Def dare_086|beg|119|length|136|forward|gi
Query_DNA-Sequence
actctgatcttttttaattttttagtttaagaaaattttttaactttcagaaaatgggctccattatttagcatgcTtagaagttcttaaattaattttttcaacaagctttctctttttgtatcaatatgtagtt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_088|beg|917|length|106|forward|gi
Query_DNA-Sequence
aaaacagtgcctacaatatcttcaagatctttagtagattttattttttttcttttgagcttcaacaataaacatctccaacatttaagtaatctTattgggctat

Coding-DNA-Entry-Section

Coding-DNA
aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt
Protein-Sequence
NSAYNIFKIFSRFYFFS
Hit-Information Section

Coding-DNA
aaacagtgcctacaatatcttcaagatctttagtagattttatttttttt
Protein-Sequence
NSAYNIFKIFSRFYFFS
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_091|beg|551|length|121|forward|gi
Query_DNA-Sequence
tttctttttttgaatattttcaatttttttaattgttagttctaaccattgtcccTattgaaaatttttcattttaaatcaacaaaTtTccatTataaatgatgtttaatatttttttgtt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_092|beg|2471|length|133|forward|gi
Query_DNA-Sequence
aaatttaaagaattcactgtcaggtgataaaattaaagatgtctgtccaccaattaaagcagtttcataggcttgcatcctctgtagaaagcaaaaaattTctgcatctcttccaaaggcttctgcaaagatc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_094|beg|1072|length|106|forward|gi
Query_DNA-Sequence
ttgctcaaatatcttcatcattTcaatggtcttacaattatttttaaagatttaatttcagTaaatttcaTggtgtttcttctttagtttcttttttttctacttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_095|beg|2392|length|134|forward|gi
Query_DNA-Sequence
ctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattttttaggttttatgttaccaaaaaaatttaaagaattcTaTcttcaggtTgataaaaattaaagatgtctgtccac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_096|beg|169|length|103|forward|gi
Query_DNA-Sequence
tggctccattatttagcatgctagaagttcttTaaattaattttttcaacaagcttttctcttttgtatcaatatgtagttttaaaaagtcactatcattaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_097|beg|1751|length|139|forward|gi
Query_DNA-Sequence
ttgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggTtataaatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgcttta

Coding-DNA-Entry-Section

Coding-DNA
tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact
Protein-Sequence
PVKFGNSDQARIGDWVIAIGQ
Hit-Information Section
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545

Coding-DNA
aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct
Protein-Sequence
KATVVGADPLSDIAVLQIDSKKNL
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561
gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515
gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216

Coding-DNA
tgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaact
Protein-Sequence
PVKFGNSDQARIGDWVIAIGQ
Hit-Information Section
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 4 from: 690882 to: 690929
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 3 from: 3917627 to: 3917656
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 1625369 to: 1625413
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 2632721 to: 2632768
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 1168188 to: 1168220
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 3 from: 1997516 to: 1997545

Coding-DNA
aatttttctttgaatctatttgaaggactgcaatatcagataagggatcagcaccaacaaccgtcgct
Protein-Sequence
KATVVGADPLSDIAVLQIDSKKNL
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 3 from: 4273161 to: 4273211
gi-nr: gi|119947346 gi_def: Arthrobacter aurescens TC1, complete genome hsp_num: 2 from: 2910520 to: 2910561
gi-nr: gi|12963466 gi_def: Pseudomonas aeruginosa MucD (mucD) gene, complete cds hsp_num: 1 from: 453 to: 515
gi-nr: gi|116608677 gi_def: Arthrobacter sp. FB24, complete genome hsp_num: 2 from: 2598104 to: 2598142
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 4823547 to: 4823609
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1652010 to: 1652078
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667681 to: 1667752
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3838127 to: 3838201
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 3 from: 1367388 to: 1367465
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 3 from: 1364538 to: 1364615
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 3 from: 1355995 to: 1356072
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 3 from: 1349293 to: 1349370
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057687 to: 1057746
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938687 to: 938746
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834337 to: 834396
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826166 to: 826225
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326666 to: 326725
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614670 to: 614729
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 49768 to: 49827
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479163 to: 2479222
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 3 from: 1887095 to: 1887172
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8511 to: 8588
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 3 from: 2486114 to: 2486164
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1175591 to: 1175644
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 2855488 to: 2855541
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99523
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609216


Query-DNA-Entry-Section

Query-DNA-Def dare_099|beg|1365|length|143|forward|gi
Query_DNA-Sequence
cagatTgggTctattttctgcaacactagcaactaatgctcctctaggttcatctaatttttcaacttcagcaatttcttcagaaactacctgaattctaacacccagccatcctcttttagtttcaccaaaTttctatcaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_104|beg|2272|length|142|forward|gi
Query_DNA-Sequence
ttataaaacctataactgcaaaaattaacccaccacttcttaattgtgTaatcttttatcatctccattttttttaacatacttttcatttttgatggaaataaggcTatataaaattccttctataaaaagaaaaagtcca

Coding-DNA-Entry-Section

Coding-DNA
gtgTaatcttttatcatctccattttttttaacatacttttcatttttg
Protein-Sequence
LCNLLSSPFFLTYFSFL
Hit-Information Section
gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175

Coding-DNA
gtgTaatcttttatcatctccattttttttaacatacttttcatttttg
Protein-Sequence
LCNLLSSPFFLTYFSFL
Hit-Information Section
gi-nr: gi|19774262 gi_def: Homo sapiens 3 BAC RP11-525C11 (Roswell Park Cancer Institute Human BAC Library) complete sequence hsp_num: 1 from: 28110 to: 28175


Query-DNA-Entry-Section

Query-DNA-Def dare_107|beg|306|length|137|forward|gi
Query_DNA-Sequence
gatatatttgtataagaTtttaatcTtcataagctcttatggTatctttgagTtaTtcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtccttctttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_108|beg|846|length|108|forward|gi
Query_DNA-Sequence
taacTaccaatatatcttctttggttttgaTttattgtaaattacaatTcaaaaTtagttttttgattagattttaaaacagtgcctacaaTtatcttcaagatcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_110|beg|1087|length|134|forward|gi
Query_DNA-Sequence
atcattcaatggtcttacaattatttttaaagatttaatttcagaaatttaggtgTtttcttctttagtttcttttttttctacTtttaaatcctctgaagttttcaagtcttcctagtttaattttttttgta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_113|beg|1503|length|107|forward|gi
Query_DNA-Sequence
attatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattccaattacatcaccattc

Coding-DNA-Entry-Section

Coding-DNA
ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca
Protein-Sequence
LELTQQFWVKVASIGIGFSIPSNDAKRVVNN
Hit-Information Section
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746
gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 2909695 to: 2909745
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427
gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357
gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545

Coding-DNA
ttatttacaactctttttgcatcgttcgatggtattgaaaaacctatcccaatagaTgccacctttacccaaaattgctgtgttaattcca
Protein-Sequence
LELTQQFWVKVASIGIGFSIPSNDAKRVVNN
Hit-Information Section
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 3993011 to: 3993064
gi-nr: gi|29417835 gi_def: Enterobacter cloacae serine protease (degQ) and putative serine protease (degS) genes, complete cds hsp_num: 2 from: 719 to: 760
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 3976838 to: 3976879
gi-nr: gi|984378 gi_def: Escherichia coli putative serine protease (degQ and degS) genes, complete cds hsp_num: 2 from: 850 to: 891
gi-nr: gi|558911 gi_def: Escherichia coli serine protease (hhoA and hhoB) genes, complete cds, and malate dehydrogenase (mdh) gene, partial cds hsp_num: 2 from: 1248 to: 1289
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 4276326 to: 4276367
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 190705 to: 190746
gi-nr: gi|153906277 gi_def: Gryllus bimaculatus mRNA, GBcontig24391 hsp_num: 2 from: 82 to: 114
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 4183910 to: 4183951
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 4116693 to: 4116734
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 3804938 to: 3804979
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 3664036 to: 3664077
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 3591124 to: 3591165
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 3711542 to: 3711583
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 3483057 to: 3483098
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 3553150 to: 3553191
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 3355234 to: 3355275
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 3470872 to: 3470913
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 3381312 to: 3381353
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 3425045 to: 3425086
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 3379479 to: 3379520
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 3369330 to: 3369371
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 3359412 to: 3359453
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 3322689 to: 3322730
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 3331987 to: 3332028
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 3160978 to: 3161019
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 3165476 to: 3165517
gi-nr: gi|606010 gi_def: Escherichia coli K-12 chromosomal region from 67.4 to 76.0 minutes hsp_num: 2 from: 162202 to: 162243
gi-nr: gi|16504263 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 14/20 hsp_num: 2 from: 163740 to: 163781
gi-nr: gi|16421897 gi_def: Salmonella typhimurium LT2, section 158 of 220 of the complete genome hsp_num: 2 from: 8101 to: 8142
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 3 from: 3709093 to: 3709143
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 3 from: 1211143 to: 1211196
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 3557522 to: 3557563
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 3 from: 574638 to: 574688
gi-nr: gi|9945003 gi_def: Aeromonas hydrophila htrA-like serine protease (prtS1) gene, complete cds hsp_num: 2 from: 715 to: 747
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866349 to: 1866399
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 1547258 to: 1547308
gi-nr: gi|7259284 gi_def: Shigella sonnei gene for heat shock protein HtrA, complete cds hsp_num: 2 from: 781 to: 813
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2055428 to: 2055472
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1302256 to: 1302306
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 2909695 to: 2909745
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 4338999 to: 4339031
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 345977 to: 346009
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 4579710 to: 4579742
gi-nr: gi|126105563 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence hsp_num: 1 from: 1119589 to: 1119639
gi-nr: gi|77389406 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 2, complete genome hsp_num: 1 from: 300184 to: 300234
gi-nr: gi|39648783 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 7/16 hsp_num: 1 from: 71458 to: 71508
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 803395 to: 803427
gi-nr: gi|42602314 gi_def: Corynebacterium glutamicum ATCC 13032 DNA, complete genome hsp_num: 1 from: 931304 to: 931357
gi-nr: gi|41324904 gi_def: Corynebacterium glutamicum ATCC 13032, IS fingerprint type 4-5, complete genome; segment 3/10 hsp_num: 1 from: 234916 to: 234969
gi-nr: gi|17740359 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 171 of 256 of the complete sequence hsp_num: 2 from: 6513 to: 6545


Query-DNA-Entry-Section

Query-DNA-Def dare_117|beg|1566|length|122|forward|gi
Query_DNA-Sequence
ctttacccaaaattctgtgttaattccaattacatcaccattcatatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataaccgagaca

Coding-DNA-Entry-Section

Coding-DNA
atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa
Protein-Sequence
VMKITFKHMHQINSGNSGGPLFEYE
Hit-Information Section
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5328856 to: 5328888
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209906 to: 3209947
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575
gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 1210072 to: 1210104
gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586
gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097
gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637
gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608998 to: 3609039
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321014 to: 2321055
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773
gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 365616 to: 365648
gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774
gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219
gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782
gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612
gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666
gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830
gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2030011 to: 2030043
gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893
gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122
gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663
gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539
gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156
gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590
gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394
gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490
gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957
gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398
gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514
gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631
gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945
gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648
gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734
gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587
gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265
gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290
gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151
gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582
gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122
gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879
gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899
gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071
gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905
gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035
gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891
gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995
gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008
gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034

Coding-DNA
atatTcaaataaaggtccgcctgagtttcctgagtttattTgatgcataTgtttgaatgtaatcttcataa
Protein-Sequence
VMKITFKHMHQINSGNSGGPLFEYE
Hit-Information Section
gi-nr: gi|110735214 gi_def: Mannheimia haemolytica strain A1 putative periplasmic serine protease precursor (htrA) gene, complete cds hsp_num: 2 from: 673 to: 702
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 229126 to: 229161
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 2 from: 2043404 to: 2043436
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 1539177 to: 1539209
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2002304 to: 2002336
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 2192264 to: 2192305
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 39529 to: 39570
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 8176443 to: 8176475
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 3 from: 3517054 to: 3517086
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 5 from: 5328856 to: 5328888
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7164976 to: 7165017
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 1881104 to: 1881145
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316854 to: 2316886
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556097 to: 2556129
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204993 to: 2205034
gi-nr: gi|32330660 gi_def: Wolbachia endosymbiont of Onchocerca volvulus serine protease gene, complete cds hsp_num: 1 from: 676 to: 711
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 2 from: 706 to: 735
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418585 to: 2418617
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 3402622 to: 3402654
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2909803 to: 2909835
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 3209906 to: 3209947
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395909 to: 1395950
gi-nr: gi|71914138 gi_def: Thermobifida fusca YX, complete genome hsp_num: 2 from: 397341 to: 397370
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 2 from: 691041 to: 691070
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 1558736 to: 1558768
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 2002065 to: 2002097
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 2 from: 514 to: 543
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1667534 to: 1667575
gi-nr: gi|126304092 gi_def: PREDICTED: Monodelphis domestica similar to HtrA serine peptidase 4 (LOC100032981), mRNA hsp_num: 2 from: 970 to: 1011
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 2 from: 976 to: 1005
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 2 from: 1072 to: 1101
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 2 from: 986 to: 1015
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 2 from: 1027 to: 1056
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065455 to: 2065496
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 465097 to: 465129
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 2 from: 430488 to: 430517
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 3 from: 1971160 to: 1971201
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 2 from: 994 to: 1023
gi-nr: gi|17740493 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 181 of 256 of the complete sequence hsp_num: 1 from: 6412 to: 6444
gi-nr: gi|125816108 gi_def: PREDICTED: Danio rerio similar to serin protease with IGF-binding motif (LOC100002317), mRNA hsp_num: 2 from: 1111 to: 1140
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455135 to: 2455167
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 3 from: 1210072 to: 1210104
gi-nr: gi|40063344 gi_def: Uncultured bacterium 580 clone EBAC000-36A07 genomic sequence hsp_num: 1 from: 64554 to: 64586
gi-nr: gi|3777622 gi_def: Oryctolagus cuniculus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 67 to: 96
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085569 to: 2085610
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118056 to: 2118097
gi-nr: gi|3777618 gi_def: Cavia porcellus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 85 to: 114
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 948660 to: 948692
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 3 from: 437605 to: 437637
gi-nr: gi|125842499 gi_def: PREDICTED: Danio rerio hypothetical LOC556364 (LOC556364), mRNA hsp_num: 1 from: 226 to: 255
gi-nr: gi|149695090 gi_def: Zebrafish DNA sequence from clone RP71-31A12, complete sequence hsp_num: 1 from: 69334 to: 69366
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 3805248 to: 3805277
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3608998 to: 3609039
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 2321014 to: 2321055
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1866457 to: 1866489
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 1057924 to: 1057956
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 938924 to: 938956
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 834574 to: 834606
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 826403 to: 826435
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 775930 to: 775962
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 326903 to: 326935
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 614907 to: 614939
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 50005 to: 50037
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 2479400 to: 2479432
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563446 to: 1563478
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 2 from: 97256 to: 97285
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 4 from: 1479403 to: 1479432
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 798970 to: 799005
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1012218 to: 1012253
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2760744 to: 2760773
gi-nr: gi|46426220 gi_def: Gallus gallus finished cDNA, clone ChEST311g23 hsp_num: 1 from: 646 to: 675
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 365616 to: 365648
gi-nr: gi|68160938 gi_def: Lactobacillus reuteri lr1799 (lr1799) gene, complete cds hsp_num: 1 from: 745 to: 774
gi-nr: gi|149596030 gi_def: PREDICTED: Ornithorhynchus anatinus similar to HTRA1 protein (LOC100093346), partial mRNA hsp_num: 1 from: 190 to: 219
gi-nr: gi|56002475 gi_def: Mus musculus cDNA, clone:Y0G0106C18, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|111073591 gi_def: Onchocerca Wolbachia Sequence Fragment OW4 hsp_num: 1 from: 9984 to: 10019
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 2 from: 970491 to: 970520
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 2 from: 967753 to: 967782
gi-nr: gi|56039777 gi_def: Mus musculus cDNA, clone:Y2G0135I24, strand:plus, reference:ENSEMBL:Mouse-Transcript-ENST:ENSMUST00000041888, based on BLAT search hsp_num: 2 from: 29 to: 58
gi-nr: gi|125822286 gi_def: PREDICTED: Danio rerio hypothetical LOC573378 (LOC573378), mRNA hsp_num: 1 from: 583 to: 612
gi-nr: gi|3777620 gi_def: Bos taurus serine protease (HTRA) mRNA, partial cds hsp_num: 1 from: 637 to: 666
gi-nr: gi|33640025 gi_def: Prochlorococcus marinus MED4 complete genome; segment 4/5 hsp_num: 2 from: 319462 to: 319491
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 2 from: 5170681 to: 5170710
gi-nr: gi|119953846 gi_def: Mycobacterium vanbaalenii PYR-1, complete genome hsp_num: 2 from: 4829801 to: 4829830
gi-nr: gi|26355513 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051E22 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 183 to: 212
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2030011 to: 2030043
gi-nr: gi|51225296 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 499 to: 528
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 2 from: 1548864 to: 1548893
gi-nr: gi|41635015 gi_def: Gallus gallus finished cDNA, clone ChEST611b2 hsp_num: 1 from: 222 to: 251
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2466980 to: 2467009
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 2 from: 1910093 to: 1910122
gi-nr: gi|76156748 gi_def: Taeniopygia guttata clone 0061P0012F10 protease serine 11 variant 3-like mRNA, complete sequence hsp_num: 1 from: 634 to: 663
gi-nr: gi|51230555 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 510 to: 539
gi-nr: gi|56362757 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 505 to: 534
gi-nr: gi|113880062 gi_def: Synechococcus sp. CC9311, complete genome hsp_num: 2 from: 2211550 to: 2211579
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 803819 to: 803848
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 974063 to: 974092
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1482810 to: 1482839
gi-nr: gi|89953508 gi_def: Cenarchaeum symbiosum A clone C20G08, complete sequence hsp_num: 2 from: 27404 to: 27433
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 2 from: 1553737 to: 1553766
gi-nr: gi|89953578 gi_def: Cenarchaeum symbiosum B clone C06A09, complete sequence hsp_num: 2 from: 27882 to: 27911
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 2 from: 1517127 to: 1517156
gi-nr: gi|12843158 gi_def: Mus musculus adult male stomach cDNA, RIKEN full-length enriched library, clone:2210021K23 product:PROBABLE SERINE PROTEASE HTRA3 PRECURSOR (EC 3.4.21.-) (TOLL- ASSOCIATED SERINE PROTEASE) homolog [Mus musculus], full insert sequence hsp_num: 1 from: 472 to: 501
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 2 from: 1506808 to: 1506837
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 2 from: 1437458 to: 1437487
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 2 from: 1413235 to: 1413264
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 1035549 to: 1035590
gi-nr: gi|50492612 gi_def: full-length cDNA clone CS0DF013YN18 of Fetal brain of Homo sapiens (human) hsp_num: 1 from: 365 to: 394
gi-nr: gi|18490473 gi_def: Mus musculus HtrA serine peptidase 3, mRNA (cDNA clone IMAGE:4216219), partial cds hsp_num: 1 from: 461 to: 490
gi-nr: gi|126332088 gi_def: PREDICTED: Monodelphis domestica similar to pregnancy-related serine protease (LOC100019928), mRNA hsp_num: 1 from: 928 to: 957
gi-nr: gi|123995390 gi_def: Synthetic construct clone IMAGE:100008831; FLH169988.01L; RZPDo839A0797D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|123980569 gi_def: Synthetic construct clone IMAGE:100003818; FLH169989.01X; RZPDo839A0798D HtrA serine peptidase 3 (HTRA3) gene, encodes complete protein hsp_num: 1 from: 920 to: 949
gi-nr: gi|3387920 gi_def: Homo sapiens clone 24795 mRNA sequence hsp_num: 1 from: 369 to: 398
gi-nr: gi|115547210 gi_def: Sus scrofa mRNA, clone:OVR010090F07, expressed in ovary hsp_num: 1 from: 485 to: 514
gi-nr: gi|74198466 gi_def: Mus musculus 12 days pregnant adult female placenta cDNA, RIKEN full-length enriched library, clone:I530027M17 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 602 to: 631
gi-nr: gi|125841758 gi_def: PREDICTED: Danio rerio hypothetical protein LOC797809 (LOC797809), mRNA hsp_num: 1 from: 631 to: 660
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 2 from: 3619630 to: 3619659
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 2 from: 1312174 to: 1312203
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 2 from: 3841916 to: 3841945
gi-nr: gi|73998933 gi_def: PREDICTED: Canis familiaris similar to Serine protease HTRA1 precursor (L56) (LOC477852), mRNA hsp_num: 1 from: 619 to: 648
gi-nr: gi|50471538 gi_def: full-length cDNA clone CS0DE011YH20 of Placenta of Homo sapiens (human) hsp_num: 1 from: 648 to: 677
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 2 from: 3457199 to: 3457228
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 2 from: 3239060 to: 3239089
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 2 from: 1545415 to: 1545444
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 2 from: 3515244 to: 3515273
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3858705 to: 3858734
gi-nr: gi|77621838 gi_def: Xenopus tropicalis finished cDNA, clone TNeu098e16 hsp_num: 1 from: 1123 to: 1152
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 92558 to: 92587
gi-nr: gi|134023796 gi_def: Xenopus tropicalis HtrA serine peptidase 1, mRNA (cDNA clone MGC:121396 IMAGE:7607815), complete cds hsp_num: 1 from: 1139 to: 1168
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 2078236 to: 2078265
gi-nr: gi|126273340 gi_def: PREDICTED: Monodelphis domestica similar to insulin-like growth factor binding protein 5 protease (LOC100025560), mRNA hsp_num: 1 from: 1261 to: 1290
gi-nr: gi|26355507 gi_def: Mus musculus 10 days pregnant adult female ovary and uterus cDNA, RIKEN full-length enriched library, clone:G630051C16 product:protease, serine, 11 (Igf binding), full insert sequence hsp_num: 1 from: 751 to: 780
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 2 from: 769122 to: 769151
gi-nr: gi|41634568 gi_def: Gallus gallus finished cDNA, clone ChEST59p14 hsp_num: 1 from: 1176 to: 1205
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1308793 to: 1308822
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 386679 to: 386720
gi-nr: gi|91199943 gi_def: Kuenenia stuttgartiensis genome fragment KUST_E (5 of 5) hsp_num: 2 from: 1103394 to: 1103423
gi-nr: gi|12057205 gi_def: Thermotoga maritima MSB8, complete genome hsp_num: 2 from: 600891 to: 600920
gi-nr: gi|147734689 gi_def: Thermotoga petrophila RKU-1, complete genome hsp_num: 2 from: 332553 to: 332582
gi-nr: gi|56366522 gi_def: Tetraodon nigroviridis full-length cDNA hsp_num: 1 from: 1093 to: 1122
gi-nr: gi|149690009 gi_def: PREDICTED: Equus caballus similar to serin protease with IGF-binding motif (LOC100064570), mRNA hsp_num: 1 from: 850 to: 879
gi-nr: gi|21750425 gi_def: Homo sapiens cDNA FLJ34625 fis, clone KIDNE2015244, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 870 to: 899
gi-nr: gi|33358216 gi_def: Mus musculus pregnancy-related serine protease mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1042 to: 1071
gi-nr: gi|21751082 gi_def: Homo sapiens cDNA FLJ35157 fis, clone PLACE6011156, highly similar to Homo sapiens mRNA for serin protease with IGF-binding motif hsp_num: 1 from: 876 to: 905
gi-nr: gi|112420558 gi_def: Gasterosteus aculeatus clone CFW261-C08 mRNA sequence hsp_num: 1 from: 1006 to: 1035
gi-nr: gi|15030191 gi_def: Homo sapiens HtrA serine peptidase 1, mRNA (cDNA clone IMAGE:4177882), partial cds hsp_num: 1 from: 862 to: 891
gi-nr: gi|50484684 gi_def: full-length cDNA clone CS0DI075YN06 of Placenta Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 966 to: 995
gi-nr: gi|50505265 gi_def: full-length cDNA clone CS0DK012YA20 of HeLa cells Cot 25-normalized of Homo sapiens (human) hsp_num: 1 from: 979 to: 1008
gi-nr: gi|31044219 gi_def: Homo sapiens pregnancy-related serine protease HTRA3 mRNA, complete cds; alternatively spliced hsp_num: 1 from: 1005 to: 1034


Query-DNA-Entry-Section

Query-DNA-Def dare_119|beg|2677|length|107|forward|gi
Query_DNA-Sequence
caTtctttgtctgcagTttgTaagtaattgtaaccgccatctctTgcacctcttgctctaaattcttttgcttctctttccctttcagtctgcattcttctataaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_120|beg|1135|length|135|forward|gi
Query_DNA-Sequence
ttcaggtgtttTcttctttagtttctttttttttctactttaaaatcctctgaagtttcaagtcTttcctagtttaattttttttgtaatctctcttttatttctccagatttaacatctacagttttaccaact

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_121|beg|2188|length|139|forward|gi
Query_DNA-Sequence
cccttgtgatgcaaaacttattgcaaaaaatataataaataatttttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaaaaattaacccaccTacttcttaattgtgaatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_122|beg|2648|length|136|forward|gi
Query_DNA-Sequence
tttattagcTatttgctaaaattaagaaacatctttgtctgcagttgaagtaattgtaaccgccatctctgcTacctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctataaattgc

Coding-DNA-Entry-Section

Coding-DNA
acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat
Protein-Sequence
MLPLALNSFASLSFQVCILL*I
Hit-Information Section

Coding-DNA
acctcttgctctaaattcttttgcttctctttcctttcaggtctgcattcttctat
Protein-Sequence
MLPLALNSFASLSFQVCILL*I
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_124|beg|1867|length|123|forward|gi
Query_DNA-Sequence
agcaccaacaaccgtcTgctttatattctttatcaccatTcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtTgattacaattccactctcttctattataaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_125|beg|399|length|122|forward|gi
Query_DNA-Sequence
aaaagttttttataaaattttttttgtccttTctttttaacattagtctaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatataga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_127|beg|429|length|118|forward|gi
Query_DNA-Sequence
tcttttttagacattagtctaactttattttctaaacttaagaggtatTctctggaaTttttaactagtccattgattaatgattgaaaatataacctgttccaccaactaaaattgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_129|beg|649|length|134|forward|gi
Query_DNA-Sequence
gtttaaatttttttgttcttgcttgttgggtcttgcagttaatattttttaatttttgtaaaacctgcatacttcggcattgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_130|beg|412|length|134|forward|gi
Query_DNA-Sequence
aaattttttttcccttcttttttagacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgattaatTattgaaaatatagacctgttccaccaactaaaattggaa

Coding-DNA-Entry-Section

Coding-DNA
gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt
Protein-Sequence
LINGLVKIPEIPLKFRNKVKTNV*K
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949
gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247
gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590

Coding-DNA
gacattagtcTtaactttatttctaaacttaagaggtatctctggaattttaactagtccattgatt
Protein-Sequence
LINGLVKIPEIPLKFRNKVKTNV*K
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2203878 to: 2203949
gi-nr: gi|21107925 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 183 of 469 of the complete genome hsp_num: 1 from: 4820 to: 4888
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1863841 to: 1863912
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1658888 to: 1658956
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2192295 to: 2192360
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1746194 to: 1746247
gi-nr: gi|25019671 gi_def: Synechococcus sp. PCC 7942 cosmids 7H1 and 2E8, complete sequence hsp_num: 1 from: 38550 to: 38603
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 2570537 to: 2570590


Query-DNA-Entry-Section

Query-DNA-Def dare_131|beg|1189|length|109|forward|gi
Query_DNA-Sequence
ttcaagtcttcctagtttaatttttttttgtaatctctcttttatttcccagattttaacatctacagttttaccaacttctgttttgtgcaacaattattggtaattc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_134|beg|2655|length|133|forward|gi
Query_DNA-Sequence
gcatttgctaaaaattacagaaacatctttgtctgcattgaagtaattgtaaccgccatctctgcacctcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgcatca

Coding-DNA-Entry-Section

Coding-DNA
tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca
Protein-Sequence
TSCSKILLLLFPFQSAFFYKLH
Hit-Information Section

Coding-DNA
tcttgctctaaaattcttttgcttctctttccctttcagtctgcattcttctataaattgca
Protein-Sequence
TSCSKILLLLFPFQSAFFYKLH
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_135|beg|1571|length|125|forward|gi
Query_DNA-Sequence
cccaaaattgctgtgttaattccaattTacatcaccattcatatcaaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga

Coding-DNA-Entry-Section

Coding-DNA
caaataaaggtccgcctggtttcctgagtttattgatgcatcagtttgaatgtaatcttcataacgagacagtccgattga
Protein-Sequence
SIGLSRYEDYIQTDASINSGNQADLYLI
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 1038184 to: 1038243
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 3 from: 2205020 to: 2205067
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 777178 to: 777240
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2466995 to: 2467057
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 1887248 to: 1887292
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 1367268 to: 1367312
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 1364418 to: 1364462
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1355875 to: 1355919
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 1349173 to: 1349217
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1177848 to: 1177910
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 446564 to: 446626
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1158669 to: 1158731
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1157008 to: 1157070
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1277786 to: 1277848
gi-nr: gi|2077988 gi_def: C.jejuni htrA gene hsp_num: 1 from: 657 to: 719
gi-nr: gi|881374 gi_def: Campylobacter jejuni heat shock protein/serine protease (htrA) and OmpR protein (ompR) genes, partial cds hsp_num: 1 from: 300 to: 362
gi-nr: gi|17982526 gi_def: Brucella melitensis 16M chromosome I, section 60 of 195 of the complete sequence hsp_num: 1 from: 8664 to: 8708
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 821479 to: 821538
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2418555 to: 2418599
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2617821 to: 2617865
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 5175321 to: 5175380
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 2535290 to: 2535349
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 2455153 to: 2455212
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835722 to: 1835769
gi-nr: gi|73979292 gi_def: PREDICTED: Canis familiaris similar to Probable serine protease HTRA4 precursor (LOC475580), mRNA hsp_num: 1 from: 682 to: 720
gi-nr: gi|149742602 gi_def: PREDICTED: Equus caballus similar to HtrA serine peptidase 4 (LOC100058701), mRNA hsp_num: 1 from: 490 to: 528
gi-nr: gi|119918200 gi_def: PREDICTED: Bos taurus similar to Probable serine protease HTRA4 (LOC514946), mRNA hsp_num: 1 from: 952 to: 990
gi-nr: gi|115549924 gi_def: Sus scrofa mRNA, clone:LNG010092F12, expressed in lung hsp_num: 1 from: 1048 to: 1086
gi-nr: gi|26091616 gi_def: Mus musculus 4 days neonate male adipose cDNA, RIKEN full-length enriched library, clone:B430206E18 product:weakly similar to PROBABLE SERINE PROTEASE HTRA4 PRECURSOR (EC 3.4.21.-) [Homo sapiens], full insert sequence hsp_num: 1 from: 962 to: 1000
gi-nr: gi|148877623 gi_def: Mus musculus HtrA serine peptidase 4, mRNA (cDNA clone MGC:175729 IMAGE:40131145), complete cds hsp_num: 1 from: 1003 to: 1041
gi-nr: gi|109504392 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008
gi-nr: gi|109503519 gi_def: PREDICTED: Rattus norvegicus HtrA serine peptidase 4 (predicted) (Htra4_predicted), mRNA hsp_num: 1 from: 970 to: 1008
gi-nr: gi|119376152 gi_def: Paracoccus denitrificans PD1222 chromosome 2, complete genome hsp_num: 1 from: 325713 to: 325757
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316824 to: 2316868
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904655 to: 904699
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118083 to: 2118127
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 2057417 to: 2057461
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 1395879 to: 1395923
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2085596 to: 2085640
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 29111 to: 29155
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563416 to: 1563460
gi-nr: gi|1184674 gi_def: Pseudomonas aeruginosa HtrA-like serine protease AlgW gene, complete cds hsp_num: 1 from: 647 to: 691


Query-DNA-Entry-Section

Query-DNA-Def dare_136|beg|1888|length|113|forward|gi
Query_DNA-Sequence
atattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaataacatgattgttTagtgattacaattccactctcttctattataaatcctgaaccaagtgca

Coding-DNA-Entry-Section

Coding-DNA
tattctttatcaccatcaactcgaaactaaaaatcttctgcattttgaata
Protein-Sequence
ILYHHQLETKNLLHFE*H
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_137|beg|1463|length|117|forward|gi
Query_DNA-Sequence
acacccagccatcctttttagtttcaccaaattctatcaattgatttacaaactctttttcatcgttcgatggtattgaaaaaccTtatcccaatagagccacctttacccaaaatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_139|beg|1739|length|127|forward|gi
Query_DNA-Sequence
aagccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtataaatttttcttttgaatctatttgaagggactgcaatatcagataaagg

Coding-DNA-Entry-Section

Coding-DNA
agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat
Protein-Sequence
FIPVKFGNSDQARIGDWVIAIGQSLWL
Hit-Information Section
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009

Coding-DNA
agccaaagggattgTccgattgcgataacccaatcaccaattcttgcttgatcagaatttccaaatttaactggtat
Protein-Sequence
FIPVKFGNSDQARIGDWVIAIGQSLWL
Hit-Information Section
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323031 to: 6323087
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3609145 to: 3609207
gi-nr: gi|39650317 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 12/16 hsp_num: 1 from: 99452 to: 99508
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 3004530 to: 3004586
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3713953 to: 3714009


Query-DNA-Entry-Section

Query-DNA-Def dare_141|beg|506|length|130|forward|gi
Query_DNA-Sequence
tgattgaaaataTtagacctgttccaccaactaaaattggaatttttttctttttttgaatattttcaattttttttaattgttagttctaaccattgtccagTttgaaatttttcatttaaatcaacTa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_143|beg|976|length|104|forward|gi
Query_DNA-Sequence
ttcaacaataacatctccaacatttaagtaatctattTgggctattttttccaatatttgttataactaaaccgttgtttgattgggtaattttctttgctcaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_144|beg|430|length|123|forward|gi
Query_DNA-Sequence
cttttttagacattagtctaactttatttctaaacttTaagaggtatctctggaattttaactagccattgattaatgattgaaatatagacctgttcccaccaactaaaattggaatttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_146|beg|2552|length|129|forward|gi
Query_DNA-Sequence
tcTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacccttcatgatttcagattctttattagcatttgctaaaattacagaaaca

Coding-DNA-Entry-Section

Coding-DNA
cTtgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaagatcttatttctttcaccaTtcaccttgacc
Protein-Sequence
RVKVNGERNKIFAEAFGRDAEFFAFYK
Hit-Information Section
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 2417151 to: 2417219
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3610391 to: 3610459
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2119180 to: 2119254
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086693 to: 2086767


Query-DNA-Entry-Section

Query-DNA-Def dare_147|beg|2563|length|138|forward|gi
Query_DNA-Sequence
caaaaaattctgcTatctcttccaaaggctttctgcTaaagatcttatttctttcaccatcaccttgacccttTcatgatttcagattctttattagcatttgctaaattacagaaacaTtctttgtcTtgcagttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_148|beg|1090|length|134|forward|gi
Query_DNA-Sequence
attcaatgtcttacaattatttttaaagatttaatttcagaaatttcaggtgTtttcttctttagtttcttttttttctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgaatctc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_150|beg|845|length|140|forward|gi
Query_DNA-Sequence
ttaacaccaatatatcttctttggtttttgattattgtaaattacaatcaaaatagttttttgatttagattttaaaacagttgcctacaatatcttcaagatctttagtagattttattttttttcttttTgagcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_151|beg|2095|length|113|forward|gi
Query_DNA-Sequence
tgtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtcttttgcaaacccttgtgatgcaaaact

Coding-DNA-Entry-Section

Coding-DNA
gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt
Protein-Sequence
QKNAPASFADLAEKLMPSVVNISTNDNSYY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544

Coding-DNA
gtagtaactgttgtcgtttgtagaaatgtttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgTtctt
Protein-Sequence
QKNAPASFADLAEKLMPSVVNISTNDNSYY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668095 to: 1668163
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118566 to: 2118637
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086079 to: 2086150
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 366129 to: 366191
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663391 to: 2663462
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 2618337 to: 2618399
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 904145 to: 904216
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 3552456 to: 3552518
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 1126994 to: 1127053
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 2 from: 3778750 to: 3778800
gi-nr: gi|148502970 gi_def: Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence hsp_num: 1 from: 171222 to: 171284
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 3837752 to: 3837811
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2556625 to: 2556693
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2360958 to: 2361020
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 2293896 to: 2293958
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 1835230 to: 1835292
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1206315 to: 1206365
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205488 to: 2205544


Query-DNA-Entry-Section

Query-DNA-Def dare_157|beg|812|length|143|forward|gi
Query_DNA-Sequence
aattttggactgcttgtccattattaaTtctagcttaacaccaaatatatcttctttggttttgattattgtaaattacaatcaaaatagttttttgaTttagattttaaaacagtgccctacaataTtcttcaagatcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_159|beg|2326|length|121|forward|gi
Query_DNA-Sequence
ttatcatctccattttttaacatacttttcatttttgatggaaataaggcatataaattcctttataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaattt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_160|beg|726|length|130|forward|gi
Query_DNA-Sequence
gcattgatgatttctccttcaattttttttgcaatcttTaacagcaaaatttgatttacctgatgcagtcggtcctgaaattaagataattttggactgcttgtccattattaatctagctaacaTccaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_161|beg|2351|length|103|forward|gi
Query_DNA-Sequence
acttttcatttttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattgctctttcattattttTagattaattttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_168|beg|456|length|131|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaattttaactagtccattgattaatgattgaaaatatagacTtgttccaccaactaaaattggaatttttttTctttttttgaatattttcaatttttttaattg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_171|beg|2344|length|139|forward|gi
Query_DNA-Sequence
ttaacatacttttcattttgatggaaataaggcatataaaattccttctataaaaagaaaaagtccaaaagctataattagctctttcattattttagattaatttttaggttttatgttaccaaaaaaatttaaagaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_172|beg|2130|length|115|forward|gi
Query_DNA-Sequence
cagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaataattttttaattctgt

Coding-DNA-Entry-Section

Coding-DNA
agatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataatTaaa
Protein-Sequence
DGINFSARSANEAGASFANPCDAKLIAKNIIK
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6132 to: 6233


Query-DNA-Entry-Section

Query-DNA-Def dare_173|beg|2099|length|109|forward|gi
Query_DNA-Sequence
gtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaactt

Coding-DNA-Entry-Section

Coding-DNA
taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVKHFYNDNSY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153

Coding-DNA
taactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgca
Protein-Sequence
FAKDAPASFADLAEKLMPSVVKHFYNDNSY
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668107 to: 1668166
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2663385 to: 2663447
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 2118581 to: 2118640
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 2086094 to: 2086153


Query-DNA-Entry-Section

Query-DNA-Def dare_174|beg|118|length|118|forward|gi
Query_DNA-Sequence
cactctgatcttttttaatttttagtttaagaaattttttaacttcTagaaatggctccattattttagcatgctagaaTttcttaaattaatttttcaacaacttttctctttttga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_176|beg|703|length|109|forward|gi
Query_DNA-Sequence
ttttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat

Coding-DNA-Entry-Section

Coding-DNA
tttgtaaacctgcatactgtcggcattgatgatttctcctttcaattttttttgcaatcttaaagcaaaatttgatttacctgatgcagtcggtcctgaaattaagat
Protein-Sequence
ILISGPTASGKSNFALRLQKKLKGEIINADSMQVYK
Hit-Information Section
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 2665684 to: 2665791
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 447944 to: 448048
gi-nr: gi|145361991 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454
gi-nr: gi|145358247 gi_def: Arabidopsis thaliana ATIPT9 (Arabidopsis thaliana isopentenyltransferase 9); ATP binding / tRNA isopentenyltransferase (ATIPT9) mRNA, complete cds hsp_num: 1 from: 347 to: 454
gi-nr: gi|14532863 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 157 to: 264
gi-nr: gi|13430591 gi_def: Arabidopsis thaliana putative IPP transferase (At5g20040) mRNA, complete cds hsp_num: 1 from: 272 to: 379
gi-nr: gi|21404588 gi_def: Arabidopsis thaliana clone 19250 mRNA, complete sequence hsp_num: 1 from: 347 to: 454
gi-nr: gi|14279069 gi_def: Arabidopsis thaliana AtIPT9 mRNA for tRNA isopentenyltransferase, complete cds hsp_num: 1 from: 157 to: 264
gi-nr: gi|147865869 gi_def: Vitis vinifera contig VV78X183130.5, whole genome shotgun sequence hsp_num: 1 from: 17496 to: 17597


Query-DNA-Entry-Section

Query-DNA-Def dare_178|beg|798|length|120|forward|gi
Query_DNA-Sequence
cctgTaaattaagataattttggactgcttgtccattattaatctagcttaacTaccaatatatcttctttggTtttttgattattgtaaattacaatcaaaatagttttttgatagatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_180|beg|1876|length|142|forward|gi
Query_DNA-Sequence
aaccgtcgctttatattctttatcaccTatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattacaattTccactctcttctattataaatcctgaaccaagtgcaTgcagacttccttgtt

Coding-DNA-Entry-Section

Coding-DNA
Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca
Protein-Sequence
MEIVITNNHVIQNAEDILVRVDR
Hit-Information Section
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510
gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586

Coding-DNA
Tatcaactcgaactaaaatatcttctgcattttgaataacatgattgttagtgattaca
Protein-Sequence
MEIVITNNHVIQNAEDILVRVDR
Hit-Information Section
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2809490 to: 2809540
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 2065767 to: 2065808
gi-nr: gi|15074950 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 8/12 hsp_num: 1 from: 195911 to: 195952
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757460 to: 5757510
gi-nr: gi|12661184 gi_def: Pseudomonas syringae pv. syringae alternate sigma factor AlgT (algT), MucA (mucA), MucB (mucB), and MucD (mucD) genes, complete cds hsp_num: 1 from: 2804 to: 2857
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 2316533 to: 2316586


Query-DNA-Entry-Section

Query-DNA-Def dare_184|beg|2553|length|112|forward|gi
Query_DNA-Sequence
ctgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcaccatcaccttgacccttcatgatttcagattctttaTttagcatttgc

Coding-DNA-Entry-Section

Coding-DNA
tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca
Protein-Sequence
CRKQKILHLFQRLLQMILFLSP
Hit-Information Section
gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317
gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216
gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555
gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692
gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175
gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353
gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857
gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104

Coding-DNA
tgtagaaagcaaaaaattctgcatctcttccaaaggcttctgcaaaTgatcttatttctttcacca
Protein-Sequence
CRKQKILHLFQRLLQMILFLSP
Hit-Information Section
gi-nr: gi|66912348 gi_def: Medicago truncatula clone mth2-10f14, complete sequence hsp_num: 1 from: 36829 to: 36879
gi-nr: gi|55831461 gi_def: Medicago truncatula clone mth2-18h17, complete sequence hsp_num: 1 from: 26267 to: 26317
gi-nr: gi|156231155 gi_def: Medicago truncatula clone mth2-103j7, complete sequence hsp_num: 1 from: 59166 to: 59216
gi-nr: gi|56710588 gi_def: Medicago truncatula chromosome 8 clone mth2-75b20, complete sequence hsp_num: 1 from: 104505 to: 104555
gi-nr: gi|45434530 gi_def: Medicago truncatula clone mth2-23f4, complete sequence hsp_num: 1 from: 65642 to: 65692
gi-nr: gi|30172641 gi_def: Medicago truncatula clone mth2-7f4, complete sequence hsp_num: 1 from: 100125 to: 100175
gi-nr: gi|82581463 gi_def: Medicago truncatula chromosome 8 clone mth2-31c9, complete sequence hsp_num: 1 from: 65303 to: 65353
gi-nr: gi|48717556 gi_def: Medicago truncatula clone mth2-4j24, complete sequence hsp_num: 1 from: 92807 to: 92857
gi-nr: gi|112703117 gi_def: M.truncatula DNA sequence from clone MTH2-87N3 on chromosome 3, complete sequence hsp_num: 1 from: 17605 to: 17655
gi-nr: gi|76058599 gi_def: Medicago truncatula chromosome 5 clone mth2-84f14, COMPLETE SEQUENCE hsp_num: 1 from: 65057 to: 65104


Query-DNA-Entry-Section

Query-DNA-Def dare_186|beg|1013|length|109|forward|gi
Query_DNA-Sequence
gggctattttttccaatatttgttataactaaacctgttgtttgattgggtaattttctttgctcaatatcttcatcattcaatggtcttacaattatttttaaagatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_187|beg|162|length|137|forward|gi
Query_DNA-Sequence
tcagaaaTtggctccattatttagcatgctagaagttcttaaattaatttttttcaacaagcttttctctttttgtatcaatatgtagttttaaaaagtcactatcattaaattcagatttagtcttagctaaccaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_188|beg|62|length|104|forward|gi
Query_DNA-Sequence
ggtaatttcatcatttagatactgtgtcaattcggcaatcccaattaccTttTgtttacactctgatcttttttaatttttagtttTaagaaattttttaactt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_191|beg|1166|length|133|forward|gi
Query_DNA-Sequence
tctactttaaaatcctctgaagtttcaagtcttcctagtttaattttttttgtaatctctcttttatttctccagattttaacatctacagtttttaccaacttctgtttgtgcaacaattattggtaattct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_192|beg|2154|length|139|forward|gi
Query_DNA-Sequence
gatccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattgcaaaaaatataataaataattttttaaattctgttctttaactttttatataccaaataattataaaacctataactgca

Coding-DNA-Entry-Section

Coding-DNA
atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg
Protein-Sequence
CNKFCITKGFAKRRTTSFAD
Hit-Information Section
gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703
gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660

Coding-DNA
atccgcaaatgaagtggtgcgtctttttgcaaaTcccttTgtgatgcaaaacttattg
Protein-Sequence
CNKFCITKGFAKRRTTSFAD
Hit-Information Section
gi-nr: gi|94384644 gi_def: Zebrafish DNA sequence from clone CH73-166N24 in linkage group 5, complete sequence hsp_num: 2 from: 60677 to: 60703
gi-nr: gi|3006210 gi_def: Drosophila melanogaster (P1 DS03279 (D209)) DNA sequence, complete sequence hsp_num: 2 from: 34634 to: 34660


Query-DNA-Entry-Section

Query-DNA-Def dare_193|beg|2191|length|126|forward|gi
Query_DNA-Sequence
ttgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaTtaactgTcaaaaattaacccaccacttcttaatt

Coding-DNA-Entry-Section

Coding-DNA
tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT
Protein-Sequence
VMQNLIAKNIINNFLIRHFNFLLPNNYKTY
Hit-Information Section
gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081

Coding-DNA
tgtgatgcaaaaTcttattgcaaaaaatataataaataattttttaattcgtcattttaactttttattaccaaataattataaaacctaT
Protein-Sequence
VMQNLIAKNIINNFLIRHFNFLLPNNYKTY
Hit-Information Section
gi-nr: gi|12666222 gi_def: Human DNA sequence from clone RP11-370F20 on chromosome 13 Contains the 5' end of the UGCGL2 gene for UDP-glucose ceramide glucosyltransferase-like 2 (HUGT2 FLJ10873 FLJ11485), the 5' end of the gene for a novel protein similar to heparan sulfate 6-sulfotransferase and two CpG islands, complete sequence hsp_num: 1 from: 12049 to: 12081


Query-DNA-Entry-Section

Query-DNA-Def dare_196|beg|644|length|129|forward|gi
Query_DNA-Sequence
atgatgtttaatatttttttgttcttgcttgttgggtcttgcagttaatatttttaatttttttgtaaacctgTcatactgtcTggcattgatgatttctccttcaattttttttgcaatcttaacaca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_197|beg|1777|length|140|forward|gi
Query_DNA-Sequence
aattcttgcTttgatcagaatttccaaatttaaTctggtataaatttttcttttgaatTctatttgaaggactgcaatatcaataagggatcTagcaccaacaaccgtcgctttatattctttatcaccatcaactcgaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_198|beg|2133|length|132|forward|gi
Query_DNA-Sequence
atggcattaatttttctgccagatccgcaaatgaagctggtgcgtcttttgcaaacccttgtgatgcaaaacttattgcaaaaaatataataaataattttttaattctgttcattttaacttttttatata

Coding-DNA-Entry-Section

Coding-DNA
tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt
Protein-Sequence
AKDAPASFADLAEKLMP
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166

Coding-DNA
tggcattaatttttctgccagatccgcaaatgaagctggtgcgtctttt
Protein-Sequence
AKDAPASFADLAEKLMP
Hit-Information Section
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1668116 to: 1668166


Query-DNA-Entry-Section

Query-DNA-Def dare_201|beg|1222|length|105|forward|gi
Query_DNA-Sequence
ctctcttttatttctccagaTttttaacaTtctaTcagttttaccaacttctgtttgtgcTaacaattTattggtaattctttcatctctttaatcttagtgtta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_206|beg|1287|length|116|forward|gi
Query_DNA-Sequence
ttggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaacactagcaactaatgctc

Coding-DNA-Entry-Section

Coding-DNA
tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa
Protein-Sequence
CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP
Hit-Information Section
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279

Coding-DNA
tggtaattctttcatctctttaatcttagtgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctttttctgcaa
Protein-Sequence
CCRKSPSDKAGIKAGDIILEFNNTKIKEMKELP
Hit-Information Section
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2715046 to: 2715111
gi-nr: gi|15073719 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 4/12 hsp_num: 2 from: 244044 to: 244073
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 882226 to: 882279


Query-DNA-Entry-Section

Query-DNA-Def dare_207|beg|706|length|102|forward|gi
Query_DNA-Sequence
tgtaaacctgcatactgtcggcttgatgatttctccttcaattttttttgcaatcttaacagcaaaatttgatttacctgtgcagtcggtcctgaaattaag

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_208|beg|2200|length|128|forward|gi
Query_DNA-Sequence
aaaacttattgcaaaaaatataataaataattttttaattctgttcattttTaacttttttatataccaaataattataaaacctataactgcaaaaattaacccacccacttcttaattgtgaatct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_211|beg|947|length|105|forward|gi
Query_DNA-Sequence
ttagtagattttattttttttcttttgagcttTcaacaataacatctccaacatttaagtaatctattgggctattttttccaatatttgttaTtaactaaacct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_213|beg|491|length|131|forward|gi
Query_DNA-Sequence
tagtccattgattaatgattgaaaatatagacctgttccaccaactaaaattggaatttttttttctttttttgaaattattttcaatttttttaattgttagttctaaccattgtccagttgaaaatttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_214|beg|1317|length|108|forward|gi
Query_DNA-Sequence
tgttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgcaactaatctcctctaggtcatctaatttttc

Coding-DNA-Entry-Section

Coding-DNA
gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc
Protein-Sequence
LHSVAENSPSDKAGIKAGDIILEFNN
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528

Coding-DNA
gttattaaactctaatataatgtctcctgctttaattcctgctttgtcagatgggctattttctgcaacactaTgc
Protein-Sequence
LHSVAENSPSDKAGIKAGDIILEFNN
Hit-Information Section
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 7169757 to: 7169843
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 1231804 to: 1231869
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 495533 to: 495592
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 50469 to: 50528


Query-DNA-Entry-Section

Query-DNA-Def dare_215|beg|889|length|99|forward|gi
Query_DNA-Sequence
aatcaaaatagtttttgattagatttttaaaacagtgcctacaatatcttcaaatctttagtagattttatttttttctttgagcttcaacaataacat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_216|beg|369|length|118|forward|gi
Query_DNA-Sequence
aatttgtcttttgaTttttaggatcaagttttaaaagttttttataaaattttttttgtccttctttttttagacattaTgtctaactttatttctaaacttaagaggtatctctgga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_217|beg|1018|length|100|forward|gi
Query_DNA-Sequence
attttttccaatatttgttTataactaaacctgttgtttgattgggtaattttttgctcaatatcttcatcattcaatgggtcttacaattatttttaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_218|beg|2103|length|133|forward|gi
Query_DNA-Sequence
tgttgtcgttgtagaaatgttacaacagatggTcattaattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaataatttttt

Coding-DNA-Entry-Section

Coding-DNA
taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata
Protein-Sequence
IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN**
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233
gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525

Coding-DNA
taattttctgccagatcccgcaaatgaagctggtgcgtcttttgcaaacccttgtgTatgcaaaacttattgcaaaaaatataataaata
Protein-Sequence
IIYYIFCNKFCIHKGLQKTHQLHLRDLAEN**
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 4 from: 6195 to: 6233
gi-nr: gi|94403481 gi_def: Pan troglodytes BAC clone CH251-11K10 from chromosome 7, complete sequence hsp_num: 2 from: 83496 to: 83525


Query-DNA-Entry-Section

Query-DNA-Def dare_220|beg|938|length|111|forward|gi
Query_DNA-Sequence
tcaagatctttagtagattttatttttttcttttggcttcaacaataacatctccaacatttaaagtaattctattgggctattttttccaatattgttataactaaaccc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_224|beg|149|length|112|forward|gi
Query_DNA-Sequence
aaattttttaacttcagaaaTtggctccattatttagcatgctagaagttcttaaattaattttttcaacaagTcttttctctttttgtTatcaatatggtagttttTaaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_229|beg|1420|length|141|forward|gi
Query_DNA-Sequence
tttttcaacttcacaatttcttcagaaacttacctgaattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaacctatcccaatag

Coding-DNA-Entry-Section

Coding-DNA
aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa
Protein-Sequence
VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920

Coding-DNA
aattctaacacccagccatcctcttttagtttcaccaaattctatcaattgatttacaactctttttgcatcgttcgatgggtattgaaaaa
Protein-Sequence
VFQYPSNDAKRVVNQLIEFGETKRGWLGVRIQ
Hit-Information Section
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2204837 to: 2204920


Query-DNA-Entry-Section

Query-DNA-Def dare_232|beg|456|length|110|forward|gi
Query_DNA-Sequence
tttctaaacttaagaggtatctctggaaatttttaactagtccattgattaatgattgaaaatatTagacctgttccaccaactaaaattggaattttttttcttttttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_233|beg|1242|length|113|forward|gi
Query_DNA-Sequence
ttttaacatctacaTgttttaccaacttctgtttgtgcaacaattattggtaattctttcatctTctttaatcttagtgtttattaaactctaatataatgtctcctgcttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_234|beg|2186|length|109|forward|gi
Query_DNA-Sequence
aacccttgtgatgcaaaacttattgcaaaaaataTtaataaatTaattttttaattctgttcattttaactttttatataccaaataattataaaacctataactgcaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_235|beg|1926|length|133|forward|gi
Query_DNA-Sequence
ctgcattttgaataacttgattgttagtgattacaattccactctcttctattataaatccTtgTaaccaagtgcagcagaTcttccttgtttgaggtgttccaaattctttTgaacatatcttcaaaaggtg

Coding-DNA-Entry-Section

Coding-DNA
tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat
Protein-Sequence
GFIIEESGIVITNNQVIQNA
Hit-Information Section
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370

Coding-DNA
tgcattttgaataacttgattgttagtgattacaattccactctcttctattataaat
Protein-Sequence
GFIIEESGIVITNNQVIQNA
Hit-Information Section
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 5757475 to: 5757534
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 6323205 to: 6323264
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 1070675 to: 1070734
gi-nr: gi|9478253 gi_def: Myxococcus xanthus 4-oxalocrotonate decarboxylase-like protein, cysteine dioxygenase-like protein, putative histidine protein kinase (hpkA), putative serine/threonine protein kinase (pknD1), putative histidine protein kinase (espA), putative membrane protein (espB), putative serine/threonine protein kinase (pknD2), putative serine protease DO-like precursor (htrA), and putative response regulator genes, complete cds; and unknown genes hsp_num: 1 from: 16693 to: 16752
gi-nr: gi|58000905 gi_def: Gluconobacter oxydans 621H, complete genome hsp_num: 1 from: 1563107 to: 1563166
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 7165297 to: 7165356
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2205311 to: 2205370


Query-DNA-Entry-Section

Query-DNA-Def dare_236|beg|39|length|140|forward|gi
Query_DNA-Sequence
attaactcttctgcttcatccaaggtaatttcatcatttagatactgtgtcaattcggcaatcccaatttaccttgtttacactctgatcttttttaatttttagtttaagaaattttttaacttcagaaatggctccat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_238|beg|298|length|131|forward|gi
Query_DNA-Sequence
catacatagatatattgtataagatttaatctcataagctcttatggatctttgagtTatcatttggatcaaatttgtctttgattttaggatcaagttttaaaagttttttataaaattttttttTgtcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_239|beg|1785|length|104|forward|gi
Query_DNA-Sequence
cttgatcagaatttccaaaatttaactggtataaatttttcttttgaatctatttgaaggactgcaatatagataagggatcagcaTccaacaaccgtcgcttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_240|beg|2650|length|122|forward|gi
Query_DNA-Sequence
tattagcatttgctaaaattacagaaacTatctttgtctgcagttgaagtaattgtaaccgccatctctgcacctttgctctaaattcttttgcTttctctttccctttcagtctgcattct

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_242|beg|2685|length|110|forward|gi
Query_DNA-Sequence
tctgcagttgaagtaattgtaaccgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcctgcattcttctataaattgcatcTactgTtttg

Coding-DNA-Entry-Section

Coding-DNA
accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc
Protein-Sequence
NRHLCTSCLNSLLLFPFQS
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728
gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836
gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331

Coding-DNA
accgccatctctgcacctcttgtctaaattctttgcttctctttccctttcagtcc
Protein-Sequence
NRHLCTSCLNSLLLFPFQS
Hit-Information Section
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 6687 to: 6728
gi-nr: gi|45016181 gi_def: Ashbya gossypii (= Eremothecium gossypii) ATCC 10895 chromosome V, complete sequence hsp_num: 1 from: 937789 to: 937836
gi-nr: gi|47073989 gi_def: Ashbya gossypii ATCC 10895 AER159Cp (AGOS_AER159C) mRNA, complete cds hsp_num: 1 from: 1284 to: 1331


Query-DNA-Entry-Section

Query-DNA-Def dare_243|beg|2274|length|118|forward|gi
Query_DNA-Sequence
aTtaaaacctataactgcaaaaattaacccaccacttcttaattgtgaatcttttatcatctccatttttttaacatacttttcattttgatggaaataaggcatataaaattccttc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_244|beg|2261|length|100|forward|gi
Query_DNA-Sequence
ataccaaaTtaattataaaacctataacTtgcaaaattaacccaccacttTcttaattgtgaatcttttatcatctccattttttaacatacttttcatt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_245|beg|865|length|117|forward|gi
Query_DNA-Sequence
ttggttttgattatttgtaaattTacaatcaaaatagttttttgattagattttaaaacagtgcctacaatatcttcaagatctttagtagattttatttttttcttttgagcttca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_247|beg|40|length|122|forward|gi
Query_DNA-Sequence
ttaactcttctgcttcatccaaggtaatttcaTtcatttagatactgtTtcaattcggcaatcccaattaccttgtttacactctgatTctttttttaatttttaTgtttaagaaattttta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_248|beg|2769|length|131|forward|gi
Query_DNA-Sequence
cttctataaattgcatcactgttttgcttgtggaaggtccgctcttttaatttctaacatctTactattttaattccaaaactttcagcttcagtatttacaccttcttgTtattaaagccatttgtttag

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_249|beg|2033|length|131|forward|gi
Query_DNA-Sequence
ttgaacatacttTcaaaaggtgatcctgggggaaactgaaaaccaggaaatggattagaatttgtagtaactgttgtcgttgtagaaatgttttacaacagatggcattaatttttctgccTagatccgca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_001|beg|1112|length|144|forward|gi
Query_DNA-Sequence
agtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctgatggaagtgga

Coding-DNA-Entry-Section

Coding-DNA
gtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctg
Protein-Sequence
SEALGKDKIVAFKPRSFNAILARVNLVLHPMKLGLDLRGWCAFPD
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 7 from: 439923 to: 439955
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 754813 to: 754845
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057551 to: 1057583
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617211 to: 617243
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123700 to: 1123741
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512623 to: 3512664
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984131 to: 2984172
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551741 to: 3551782
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123988 to: 1124029
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051128 to: 1051169
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 358 to: 399
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 358 to: 399
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650563 to: 2650604
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245634 to: 3245675
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635663 to: 1635704
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479619 to: 1479660
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622164 to: 1622205
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245607 to: 2245648
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241641 to: 2241682
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219100 to: 2219141
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376708 to: 3376749
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847374 to: 2847415
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40139 to: 40183
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274892 to: 1274933
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109746 to: 1109787
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145064 to: 1145105
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6379 to: 6420
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11911 to: 11952

Coding-DNA
gtgaagcgttaggtaaggataaaatcgtcgcgttTaaacctcgctccttcaacgccatattggctagagtcaattTggtgctgcaTccaatgaaactcggccttgatctgcgtggTtggtgtgcaTttcctg
Protein-Sequence
SEALGKDKIVAFKPRSFNAILARVNLVLHPMKLGLDLRGWCAFPD
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 7 from: 439923 to: 439955
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 754813 to: 754845
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057551 to: 1057583
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617211 to: 617243
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123700 to: 1123741
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512623 to: 3512664
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984131 to: 2984172
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551741 to: 3551782
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123988 to: 1124029
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051128 to: 1051169
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 358 to: 399
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 358 to: 399
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650563 to: 2650604
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245634 to: 3245675
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635663 to: 1635704
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479619 to: 1479660
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622164 to: 1622205
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245607 to: 2245648
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241641 to: 2241682
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219100 to: 2219141
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376708 to: 3376749
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847374 to: 2847415
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40139 to: 40183
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274892 to: 1274933
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109746 to: 1109787
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145064 to: 1145105
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6379 to: 6420
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11911 to: 11952


Query-DNA-Entry-Section

Query-DNA-Def dare_002|beg|1658|length|102|forward|gi
Query_DNA-Sequence
atcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgctggcTagcgaaatca

Coding-DNA-Entry-Section

Coding-DNA
tcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgc
Protein-Sequence
ILGATATLEFREVDDKADLCRCGSRTCAC
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287368 to: 287424
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439335 to: 439406
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755362 to: 755433
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204783 to: 2204854
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058100 to: 1058156
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617760 to: 617816
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130252 to: 130308
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245157 to: 3245213
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3044899 to: 3044928
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337053 to: 337109
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882086 to: 2882139
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274669 to: 3274722
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732319 to: 1732372
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240468 to: 3240521
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803316 to: 2803372
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 394005 to: 394034
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650086 to: 2650142

Coding-DNA
tcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttTgccgctgcggcagcaggacgtgcgcctgc
Protein-Sequence
ILGATATLEFREVDDKADLCRCGSRTCAC
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287368 to: 287424
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439335 to: 439406
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755362 to: 755433
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204783 to: 2204854
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058100 to: 1058156
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617760 to: 617816
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130252 to: 130308
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245157 to: 3245213
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3044899 to: 3044928
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337053 to: 337109
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882086 to: 2882139
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274669 to: 3274722
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732319 to: 1732372
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240468 to: 3240521
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803316 to: 2803372
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 394005 to: 394034
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650086 to: 2650142


Query-DNA-Entry-Section

Query-DNA-Def dare_003|beg|2862|length|126|forward|gi
Query_DNA-Sequence
tgaagtggctttgaacagcctgccaatcTtggagcaaatccgtagcgcccttgaagcTgaaaggttttggtgatgctaccgtgcaaacttttggttctgcacgtgatgtgatggTtacgtctacgt

Coding-DNA-Entry-Section

Coding-DNA
gcccttgaagcTgaaaggttttggtgatgctaccgtgcaaacttttggttctgcacgtgatgtgatggTtacgtctacg
Protein-Sequence
APLKLKGFGDATVQTFGSARDVMVTST
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756615 to: 756680
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438088 to: 438153
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1059347 to: 1059418
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 619013 to: 619078


Query-DNA-Entry-Section

Query-DNA-Def dare_011|beg|1221|length|135|forward|gi
Query_DNA-Sequence
gtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcgatccgtccattatcg

Coding-DNA-Entry-Section

Coding-DNA
tggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcg
Protein-Sequence
SRGKRIFSSRRSLRKASSCWLTNFSIAASISTSIRKCTPP
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617321 to: 617428
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057661 to: 1057768
gi-nr: gi|212803 gi_def: Chicken tropoelastin mRNA, complete cds hsp_num: 2 from: 1250 to: 1285
gi-nr: gi|212741 gi_def: Chicken tropoelastin mRNA, 3' end hsp_num: 2 from: 1069 to: 1104
gi-nr: gi|74195328 gi_def: Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library, clone:G370038P06 product:unclassifiable, full insert sequence hsp_num: 1 from: 1271 to: 1312
gi-nr: gi|121713911 gi_def: Aspergillus clavatus NRRL 1 C2H2 type zinc finger domain protein (ACLA_015870) mRNA, complete cds hsp_num: 2 from: 629 to: 667

Coding-DNA
tggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcgTttaccgcgcg
Protein-Sequence
SRGKRIFSSRRSLRKASSCWLTNFSIAASISTSIRKCTPP
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617321 to: 617428
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057661 to: 1057768
gi-nr: gi|212803 gi_def: Chicken tropoelastin mRNA, complete cds hsp_num: 2 from: 1250 to: 1285
gi-nr: gi|212741 gi_def: Chicken tropoelastin mRNA, 3' end hsp_num: 2 from: 1069 to: 1104
gi-nr: gi|74195328 gi_def: Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library, clone:G370038P06 product:unclassifiable, full insert sequence hsp_num: 1 from: 1271 to: 1312
gi-nr: gi|121713911 gi_def: Aspergillus clavatus NRRL 1 C2H2 type zinc finger domain protein (ACLA_015870) mRNA, complete cds hsp_num: 2 from: 629 to: 667


Query-DNA-Entry-Section

Query-DNA-Def dare_012|beg|1245|length|137|forward|gi
Query_DNA-Sequence
aaagtggatatggatgccgcgatggaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcTgttaccgcgTcgatccgtccattatcggatgcggttgaagtgaccctgcgtg

Coding-DNA-Entry-Section

Coding-DNA
aagtggatatggatgccgcgatggaaaattggtcagccaacaagaagaagctttccgcagtgatctgcgtgacgagaaaattcTgttaccgcgT
Protein-Sequence
SGYGCRDGKLVSQQEEAFRSDLRDEKILLPR
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754972 to: 755028
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439740 to: 439796
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617370 to: 617426
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057710 to: 1057766


Query-DNA-Entry-Section

Query-DNA-Def dare_017|beg|190|length|118|forward|gi
Query_DNA-Sequence
tgcatcTatcggatcgctgtaacgaaatcctcgtgcacgcttgaatactatccataacctgcgttactaccaacgcTttgatggaaagcattcgtaagcgattgatgaagaccgtttt

Coding-DNA-Entry-Section

Coding-DNA
cctcgtgcacgcttgaatactatccataacctgcgttactaccaacgcTttgatggaaagcattcg
Protein-Sequence
NPRARLNTIHNLRYYQRFDGKHS
Hit-Information Section
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3637 to: 3720
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117286 to: 1117369
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804714 to: 2804755
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651447 to: 2651488
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900525 to: 1900566
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478675 to: 1478716
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335694 to: 335735
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3495841 to: 3495882
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245106 to: 245144
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267523 to: 267561
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168894 to: 1168935
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364022 to: 3364060
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883444 to: 2883482
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730684 to: 2730722
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276026 to: 3276064
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730976 to: 1731014
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665275 to: 1665313
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246516 to: 3246554
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681931 to: 1681969
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610503 to: 1610541
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634781 to: 1634819
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241825 to: 3241863
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696831 to: 2696872
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163250 to: 3163291
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551269 to: 551310


Query-DNA-Entry-Section

Query-DNA-Def dare_019|beg|543|length|111|forward|gi
Query_DNA-Sequence
ttgaaaatgatcatcatgctcgcgatgttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatggc

Coding-DNA-Entry-Section

Coding-DNA
ttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatg
Protein-Sequence
CFAVIFYFMIYRPQAKRVKEHKNLMAAM
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616668 to: 616748
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057008 to: 1057088
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205898 to: 2205978
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440418 to: 440498
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754270 to: 754350
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129159 to: 129239
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154884 to: 1154964
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335963 to: 336043
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2286090 to: 2286170
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246218 to: 3246298
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 727093 to: 727173
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274262 to: 1274333
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622752 to: 1622817
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2242229 to: 2242294
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219688 to: 2219753
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2246195 to: 2246260

Coding-DNA
ttTcgcagtgatcttctatttcatgatctaccgtccacaagctaagcgtgtcaaagaacacaaaaacctgatggctgcgatg
Protein-Sequence
CFAVIFYFMIYRPQAKRVKEHKNLMAAM
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616668 to: 616748
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057008 to: 1057088
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205898 to: 2205978
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440418 to: 440498
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754270 to: 754350
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129159 to: 129239
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154884 to: 1154964
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335963 to: 336043
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2286090 to: 2286170
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246218 to: 3246298
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 727093 to: 727173
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274262 to: 1274333
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622752 to: 1622817
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2242229 to: 2242294
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219688 to: 2219753
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2246195 to: 2246260


Query-DNA-Entry-Section

Query-DNA-Def dare_020|beg|164|length|102|forward|gi
Query_DNA-Sequence
ttgcaaaaattattcgaagtcatacctgcatTcatctggatcTgctgtaacgaaacctcggtgcacggcttgaatactatccataacctgcgttactaccaa

Coding-DNA-Entry-Section

Coding-DNA
tgcaaaaattattcgaagtcatacctgcatTcatctggatcTgctgtaacgaaacctcggtgcacggcttgaatactatccataacctgcgttactaccaa
Protein-Sequence
LQKLFEVIPAFIWICCNETSVHGLNTIHNLRYYQ
Hit-Information Section
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364022 to: 3364078
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276026 to: 3276082
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665257 to: 1665313
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241825 to: 3241881
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681913 to: 1681969
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730958 to: 1731014
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610485 to: 1610541
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883444 to: 2883500
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627265 to: 627321
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128880 to: 128936
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 2 from: 988 to: 1020
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 2 from: 1066 to: 1098
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 971310 to: 971342
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1161473 to: 1161505
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1091110 to: 1091142
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 825542 to: 825574
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 829198 to: 829230
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1130170 to: 1130202
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1130121 to: 1130153
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 827297 to: 827329
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245085 to: 245141
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976504 to: 976560
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300220 to: 300249
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 692933 to: 692965
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 898882 to: 898914
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295623 to: 295655


Query-DNA-Entry-Section

Query-DNA-Def dare_021|beg|686|length|143|forward|gi
Query_DNA-Sequence
gtgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTttcgtTgactgcagtgctaccaaaaTgggtacgctgaaatctctttaaaacgc

Coding-DNA-Entry-Section

Coding-DNA
tgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTtt
Protein-Sequence
GSYLLRLLKITLTSQFELNTNNEVVIKKDF
Hit-Information Section
gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 5 from: 250 to: 291
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 286444 to: 286485
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 795734 to: 795775
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616833 to: 616874
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754476
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440292 to: 440333
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057214

Coding-DNA
tgggtcgtatcTactaagattgctgaagataacgcttacatcacaaTtcgagttgaacaccaacaacgaagttgtgatcaagaaggacTtt
Protein-Sequence
GSYLLRLLKITLTSQFELNTNNEVVIKKDF
Hit-Information Section
gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 5 from: 250 to: 291
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 286444 to: 286485
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 795734 to: 795775
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616833 to: 616874
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754476
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440292 to: 440333
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057214


Query-DNA-Entry-Section

Query-DNA-Def dare_022|beg|1752|length|128|forward|gi
Query_DNA-Sequence
aaatcTaagttcgatcgtaatggTtcgtcctgtggtgctgaaaaagcgcgtTgattctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggtgaacatttcg

Coding-DNA-Entry-Section

Coding-DNA
gcgcgtTgattctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggtgaacatttcg
Protein-Sequence
SALILGGSSITDASSSADEYGRPQVNIS
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204636 to: 2204722
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058232 to: 1058318
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130384 to: 130470
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439188 to: 439274
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755494 to: 755580
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617892 to: 617978


Query-DNA-Entry-Section

Query-DNA-Def dare_023|beg|2375|length|141|forward|gi
Query_DNA-Sequence
gtgttgacgggtcgggtatggcggtcTgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgccgatgc

Coding-DNA-Entry-Section

Coding-DNA
aaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgcc
Protein-Sequence
RRKNPQLSDSSMVTLTHSVPLP
Hit-Information Section

Coding-DNA
aaggaaaaatccgcagcTaagcgattcatcaaTggttacgctaacgcattcagtaccattgcc
Protein-Sequence
RRKNPQLSDSSMVTLTHSVPLP
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_024|beg|2600|length|133|forward|gi
Query_DNA-Sequence
atttttaaccttatgttttaccgcgattgtgggtacacgtttgtatcgtgaacctgctgtatggcggcaaacgtatcaacaaactgtcgatctgaggctggggtaagttatgtttcaaatcctaaaagcagac

Coding-DNA-Entry-Section

Coding-DNA
cttatgttttaccgcgattgtgggtacacgtttgtatcgtgaacctgctgtatggcggcaaacgtatcaacaaactgtcgatc
Protein-Sequence
PYVLPRLWVHVCIVNLLYGGKRINKLSI
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 288349 to: 288438
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438336 to: 438425
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756343 to: 756432
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1798 to: 1848
gi-nr: gi|28875437 gi_def: Uncultured bacterium plasmid pAK116 YaaU (yaaU) gene, partial cds; and Orf23, YabF (yabF), and SecF (secF) genes, complete cds hsp_num: 1 from: 1826 to: 1879
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 2887 to: 2940
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2553029 to: 2553082
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171229 to: 1171282
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2845922 to: 2845975
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511171 to: 3511224
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197244 to: 3197297
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436420 to: 3436473
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550289 to: 3550342
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805183 to: 805236
gi-nr: gi|109693602 gi_def: Synthetic construct Yersinia pestis clone FLH0149330.01X secF gene, complete sequence hsp_num: 1 from: 6 to: 59
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982679 to: 2982732
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052568 to: 1052621
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125428 to: 1125481
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1125140 to: 1125193
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276332 to: 1276385
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1798 to: 1848
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1798 to: 1848
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 13502 to: 13555
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 205333 to: 205386
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 2408866 to: 2408919
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 2524714 to: 2524767
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 508620 to: 508673
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1111186 to: 1111242
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 462319 to: 462372
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 493236 to: 493289
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 402178 to: 402231
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 978850 to: 978903
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 445416 to: 445469
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 393041 to: 393094
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 496934 to: 496987
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 443827 to: 443880
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 358942 to: 358995
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 428668 to: 428721
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 428668 to: 428721
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 503635 to: 503688
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 358077 to: 358130
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 493073 to: 493126
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 493075 to: 493128
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 8894 to: 8947
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 314412 to: 314465
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 318415 to: 318468
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 414538 to: 414591
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 55969 to: 56022
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 1798 to: 1848
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1083 to: 1133
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503371 to: 1503424
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 482 to: 535
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268864 to: 1268917


Query-DNA-Entry-Section

Query-DNA-Def dare_026|beg|474|length|117|forward|gi
Query_DNA-Sequence
gacgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttca

Coding-DNA-Entry-Section

Coding-DNA
acgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttc
Protein-Sequence
RFSMSLISVAHAAGEGAPQGGGFEMIIMLAMFAVIFYF
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205958 to: 2206053

Coding-DNA
acgtttctcaatgagtttaatttctgtagcacatgccgcaggcgaaggtgccccacaaggtggcggttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttc
Protein-Sequence
RFSMSLISVAHAAGEGAPQGGGFEMIIMLAMFAVIFYF
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205958 to: 2206053


Query-DNA-Entry-Section

Query-DNA-Def dare_029|beg|1466|length|103|forward|gi
Query_DNA-Sequence
ttttgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactagccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggt

Coding-DNA-Entry-Section

Coding-DNA
cgaagctcgcttacaggaaattcgcaactagccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggt
Protein-Sequence
YRSSLTGNSQLAVEQNITILRNRVNELG
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755224 to: 755274
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439494 to: 439544
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130114 to: 130164
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057962 to: 1058012
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617622 to: 617672
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204942 to: 2204992
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170101 to: 1170157
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512296 to: 3512352
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198369 to: 3198425
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803460 to: 2803510
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729445 to: 2729495
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437545 to: 3437601
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901769 to: 1901819
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551414 to: 3551470
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804055 to: 804111
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 670 to: 726
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983804 to: 2983860
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051440 to: 1051496
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124300 to: 1124356
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124012 to: 1124068
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57094 to: 57144
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695140 to: 2695196
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145376 to: 1145432
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285168 to: 2285218
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233705 to: 233755
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232430 to: 232480
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765961 to: 2766011
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853470 to: 1853523
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110064 to: 1110114
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172561 to: 2172617
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461191 to: 461247
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492108 to: 492164
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444288 to: 444344
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391913 to: 391969
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495806 to: 495862
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442699 to: 442755
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357814 to: 357870
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427540 to: 427596
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427540 to: 427596
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502507 to: 502563
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1759 to: 1815
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356949 to: 357005
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275204 to: 1275260
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491945 to: 492001
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491947 to: 492003
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7766 to: 7822
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315537 to: 315593
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317287 to: 317343
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413410 to: 413466
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362806 to: 3362856
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40463 to: 40513
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274810 to: 3274860
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240596 to: 1240646
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940417 to: 940467
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073435 to: 1073485
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514484 to: 1514534
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637418 to: 637468
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990495 to: 2990545
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882227 to: 2882277
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 2 from: 793792 to: 793842
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 2 from: 580022 to: 580072
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732181 to: 1732231
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666479 to: 1666529
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245301 to: 3245351
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683135 to: 1683185
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611707 to: 1611757
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446590 to: 1446640
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59295 to: 59345
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578071 to: 578121
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240609 to: 3240659
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6685 to: 6741
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371567 to: 3371617
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 2 from: 3202747 to: 3202797
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612240 to: 2612290
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080813 to: 3080863
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050258 to: 3050308
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2477 to: 2527
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2316 to: 2366
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101744 to: 2101794
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417577 to: 1417627
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190651 to: 190701
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632467 to: 2632517
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12223 to: 12273


Query-DNA-Entry-Section

Query-DNA-Def dare_032|beg|800|length|122|forward|gi
Query_DNA-Sequence
acgctgaaatctcttttaaaacagccataggatcctcTgctgtgctaaaccgttatccggttatggaagtatctgatggtgatgttaaccatTcgccgttgcagccttgtatgcaTcttcca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_034|beg|2422|length|140|forward|gi
Query_DNA-Sequence
gcgtatttcgtgaagagctacgcgaaggTaaaaaatcccgagcaagcgattcatcaaggttacTgctaacgcattcagtaccattgccgtgccaacatcaccaTccttaattacggcgatcaTtttttgtttgccgttgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_036|beg|274|length|125|forward|gi
Query_DNA-Sequence
aaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcggtgcactgggttggat

Coding-DNA-Entry-Section

Coding-DNA
aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg
Protein-Sequence
SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672
gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595

Coding-DNA
aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg
Protein-Sequence
SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672
gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595

Coding-DNA
aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgaaccgcgaagtgccaccactacaaaagacaaagcctgattcg
Protein-Sequence
SIRKAIDEDRFDQFVAEFYARRTAKCHHYKRQSLIR
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 285986 to: 286051
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 795276 to: 795341
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 3 from: 1036 to: 1101
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616323 to: 616388
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056648 to: 1056713
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206193 to: 2206258
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129014
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393403 to: 2393465
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334758 to: 334817
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728172 to: 728231
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352613 to: 352672
gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 163 to: 222
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271645 to: 271704
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156581 to: 1156640
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554536 to: 1554595


Query-DNA-Entry-Section

Query-DNA-Def dare_037|beg|10|length|104|forward|gi
Query_DNA-Sequence
gtgtgcgtcTgtggtatcgacatgtttgactgtgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgatcaagatccgtaatgc

Coding-DNA-Entry-Section

Coding-DNA
tgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgat
Protein-Sequence
LCMPTRNARNGHLFVTGWCD
Hit-Information Section
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 1 from: 805 to: 849
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 285755 to: 285799
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 795045 to: 795089
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056417 to: 1056461
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753739 to: 753783
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616092 to: 616136
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206489
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128718 to: 128762
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440985 to: 441029
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58553 to: 58594
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 799 to: 840
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1013 to: 1054
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1014 to: 1055
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108373 to: 2108426
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315906 to: 315947
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393714
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156833 to: 1156874
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554302 to: 1554343
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335010 to: 335051
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728424 to: 728465
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271897 to: 271938
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352379 to: 352420
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202824 to: 202865
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6385 to: 6426
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10993 to: 11034
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335514 to: 335555
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139952 to: 139993
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831882 to: 831923
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505990 to: 1506031
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117106 to: 1117147
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627103 to: 627144
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681751 to: 1681792
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610323 to: 1610364
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3859 to: 3900
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139462 to: 139503
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3663 to: 3701
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2948 to: 2986
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 63 to: 101
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9826 to: 9864
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3664 to: 3702
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3056 to: 3094
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688262 to: 688297
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712916 to: 712951
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267340 to: 267381
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4169 to: 4210
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168714 to: 1168755
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555550 to: 2555591
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459810 to: 459851
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490727 to: 490768
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848442 to: 2848483
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513781 to: 3513822
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399670 to: 399711
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976342 to: 976383
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199854 to: 3199895
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439040 to: 3439081
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442907 to: 442948
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552899 to: 3552940
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802585 to: 802626
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390532 to: 390573
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494425 to: 494466
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478495 to: 1478536
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985289 to: 2985330
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049970 to: 1050011
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122830 to: 1122871
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441318 to: 441359
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356433 to: 356474
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108678 to: 1108719
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426159 to: 426200
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426159 to: 426200
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501126 to: 501167
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355568 to: 355609
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122542 to: 1122583
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273718 to: 1273759
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490564 to: 490605
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411387 to: 2411428
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527235 to: 2527276
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506111 to: 506152
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490566 to: 490607
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316933 to: 316974
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412029 to: 412070
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 158
gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 35 to: 70
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939495 to: 939536
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300034 to: 300069
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749934
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693151
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867707 to: 1867742
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295841
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496021 to: 3496062
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804894 to: 2804935
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697011 to: 2697052
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900345 to: 1900386
gi-nr: gi|83596024 gi_def: Uncultured marine bacterium Ant39E11, partial genomic sequence hsp_num: 1 from: 4568 to: 4609
gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14056 to: 14091
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899100
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244920 to: 244955
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307010 to: 1307048
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985608 to: 985646
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879338 to: 3879376
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375542 to: 3375583
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246777 to: 1246815
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279677 to: 4279715
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054205 to: 1054243
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696599
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143635 to: 1143673
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579574 to: 579615
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970942 to: 970980
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178858
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65671
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59627 to: 59662
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48780
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551089 to: 551127
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219819 to: 5219857
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726389 to: 5726427
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553850 to: 1553888
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448226
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665927 to: 665962
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364199 to: 3364240
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883621 to: 2883662
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730861 to: 2730902
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276203 to: 3276244
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730796 to: 1730837
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651627 to: 2651668
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246693 to: 3246734
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634601 to: 1634642
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280973 to: 3281008
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949332
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481776
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822760 to: 1822795
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512640 to: 1512675
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529920 to: 3529955
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387225 to: 1387260
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339970 to: 340005

Coding-DNA
tgtatgccaacgcgtaacgcacgtaacggtcacctatttgtgacggggtggtgtgat
Protein-Sequence
LCMPTRNARNGHLFVTGWCD
Hit-Information Section
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 1 from: 805 to: 849
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 285755 to: 285799
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 795045 to: 795089
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056417 to: 1056461
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753739 to: 753783
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616092 to: 616136
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206489
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128718 to: 128762
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440985 to: 441029
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58553 to: 58594
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 799 to: 840
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1013 to: 1054
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1014 to: 1055
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108373 to: 2108426
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315906 to: 315947
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393714
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156833 to: 1156874
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554302 to: 1554343
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335010 to: 335051
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728424 to: 728465
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271897 to: 271938
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352379 to: 352420
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202824 to: 202865
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6385 to: 6426
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10993 to: 11034
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335514 to: 335555
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139952 to: 139993
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831882 to: 831923
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505990 to: 1506031
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117106 to: 1117147
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627103 to: 627144
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681751 to: 1681792
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610323 to: 1610364
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3859 to: 3900
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139462 to: 139503
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3663 to: 3701
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2948 to: 2986
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 63 to: 101
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9826 to: 9864
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3664 to: 3702
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3056 to: 3094
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688262 to: 688297
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712916 to: 712951
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267340 to: 267381
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4169 to: 4210
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168714 to: 1168755
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555550 to: 2555591
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459810 to: 459851
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490727 to: 490768
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848442 to: 2848483
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513781 to: 3513822
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399670 to: 399711
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976342 to: 976383
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199854 to: 3199895
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439040 to: 3439081
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442907 to: 442948
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552899 to: 3552940
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802585 to: 802626
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390532 to: 390573
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494425 to: 494466
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478495 to: 1478536
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985289 to: 2985330
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049970 to: 1050011
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122830 to: 1122871
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441318 to: 441359
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356433 to: 356474
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108678 to: 1108719
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426159 to: 426200
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426159 to: 426200
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501126 to: 501167
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355568 to: 355609
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122542 to: 1122583
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273718 to: 1273759
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490564 to: 490605
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411387 to: 2411428
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527235 to: 2527276
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506111 to: 506152
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490566 to: 490607
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316933 to: 316974
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412029 to: 412070
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 158
gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 35 to: 70
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939495 to: 939536
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 300034 to: 300069
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749934
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693151
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867707 to: 1867742
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295841
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496021 to: 3496062
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804894 to: 2804935
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697011 to: 2697052
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900345 to: 1900386
gi-nr: gi|83596024 gi_def: Uncultured marine bacterium Ant39E11, partial genomic sequence hsp_num: 1 from: 4568 to: 4609
gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14056 to: 14091
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899100
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244920 to: 244955
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307010 to: 1307048
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985608 to: 985646
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879338 to: 3879376
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375542 to: 3375583
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246777 to: 1246815
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279677 to: 4279715
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054205 to: 1054243
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696599
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143635 to: 1143673
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579574 to: 579615
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970942 to: 970980
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178858
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65671
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59627 to: 59662
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48780
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551089 to: 551127
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219819 to: 5219857
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726389 to: 5726427
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553850 to: 1553888
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448226
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665927 to: 665962
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364199 to: 3364240
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883621 to: 2883662
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730861 to: 2730902
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276203 to: 3276244
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730796 to: 1730837
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651627 to: 2651668
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246693 to: 3246734
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634601 to: 1634642
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280973 to: 3281008
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949332
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481776
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822760 to: 1822795
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512640 to: 1512675
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529920 to: 3529955
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387225 to: 1387260
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339970 to: 340005


Query-DNA-Entry-Section

Query-DNA-Def dare_040|beg|1586|length|136|forward|gi
Query_DNA-Sequence
gttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttgccgc

Coding-DNA-Entry-Section

Coding-DNA
ttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttg
Protein-Sequence
FNRQGATRIVVELPGVQDTARAKEILGATATLVIFVKWTIKPTC
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 848 to: 874
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 796686 to: 796712
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287396 to: 287422
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287302 to: 287391
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058034 to: 1058123
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755296 to: 755385
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617694 to: 617783
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439383 to: 439472
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204831 to: 2204920
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130186 to: 130275
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504388 to: 1504477
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2097 to: 2186
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554043 to: 2554132
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461269 to: 461358
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492186 to: 492275
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332605 to: 332694
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846936 to: 2847025
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153855 to: 1153944
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726019 to: 726108
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354736 to: 354825
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444366 to: 444455
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391991 to: 392080
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495884 to: 495973
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442777 to: 442866
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357892 to: 357981
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556675 to: 1556764
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110136 to: 1110225
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427618 to: 427707
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427618 to: 427707
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12452 to: 12541
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502585 to: 502674
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1837 to: 1926
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357027 to: 357116
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275282 to: 1275371
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56983 to: 57072
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204283 to: 204372
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492023 to: 492112
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409880 to: 2409969
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525728 to: 2525817
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507570 to: 507659
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269492 to: 269581
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492025 to: 492114
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7844 to: 7933
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315426 to: 315515
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317365 to: 317454
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413488 to: 413577
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401128 to: 401217
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235596 to: 1235685
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285057 to: 2285146
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463699 to: 1463788
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170179 to: 1170268
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512185 to: 3512274
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977800 to: 977889
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198258 to: 3198347
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437434 to: 3437523
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551303 to: 3551392
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804133 to: 804222
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 748 to: 837
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983693 to: 2983782
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051518 to: 1051607
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124378 to: 1124467
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124090 to: 1124179
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803349 to: 2803438
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901841 to: 1901930
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336987 to: 337076
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362695 to: 3362784
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882116 to: 2882205
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274699 to: 3274788
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732253 to: 1732342
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650119 to: 2650208
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666551 to: 1666640
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245190 to: 3245279
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683207 to: 1683296
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611779 to: 1611868
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636059 to: 1636148
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240498 to: 3240587
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695400 to: 2695489
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420005 to: 1420094
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494505 to: 3494594
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987132 to: 987221
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729334 to: 2729423
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724804 to: 5724893
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972466 to: 972555
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695029 to: 2695118
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714443 to: 714532
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308534 to: 1308623
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1248301 to: 1248390
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4278102 to: 4278191
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1055729 to: 1055818
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 2 from: 1514178 to: 1514267
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279397 to: 3279486
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267820 to: 1267909
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446479 to: 1446568
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531418 to: 3531513
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940306 to: 940395
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1869300 to: 1869389
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172639 to: 2172734
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853359 to: 1853448
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628555 to: 628644
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164646 to: 3164735
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621723 to: 1621812
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877760 to: 3877849
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533785 to: 533880
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1358 to: 1447
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8236 to: 8325
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1466 to: 1555
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218239 to: 5218328
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241200 to: 2241289
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317786 to: 4317881
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218659 to: 2218748
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245166 to: 2245255
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388763 to: 1388852
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555387 to: 1555476
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990384 to: 2990473
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301623 to: 301718
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371639 to: 3371728
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080885 to: 3080974
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233777 to: 233866
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232502 to: 232591
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169633 to: 5169728
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480006 to: 1480095
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59184 to: 59273
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261551 to: 4261646
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968881 to: 968976
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140901 to: 4140990
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928798 to: 4928887
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40535 to: 40624
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597476 to: 4597565
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765844 to: 2765933
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921378 to: 2921467
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44908 to: 44997

Coding-DNA
ttcaaTcgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgTaattttcgtgaagtggacgataaagccgacttg
Protein-Sequence
FNRQGATRIVVELPGVQDTARAKEILGATATLVIFVKWTIKPTC
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 848 to: 874
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 796686 to: 796712
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287396 to: 287422
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287302 to: 287391
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058034 to: 1058123
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755296 to: 755385
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617694 to: 617783
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439383 to: 439472
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204831 to: 2204920
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130186 to: 130275
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504388 to: 1504477
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2097 to: 2186
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554043 to: 2554132
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461269 to: 461358
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492186 to: 492275
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332605 to: 332694
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846936 to: 2847025
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153855 to: 1153944
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726019 to: 726108
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354736 to: 354825
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444366 to: 444455
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391991 to: 392080
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495884 to: 495973
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442777 to: 442866
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357892 to: 357981
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556675 to: 1556764
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110136 to: 1110225
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427618 to: 427707
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427618 to: 427707
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12452 to: 12541
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502585 to: 502674
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1837 to: 1926
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357027 to: 357116
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275282 to: 1275371
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56983 to: 57072
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204283 to: 204372
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492023 to: 492112
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409880 to: 2409969
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525728 to: 2525817
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507570 to: 507659
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269492 to: 269581
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492025 to: 492114
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7844 to: 7933
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315426 to: 315515
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317365 to: 317454
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413488 to: 413577
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401128 to: 401217
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235596 to: 1235685
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285057 to: 2285146
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463699 to: 1463788
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170179 to: 1170268
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512185 to: 3512274
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977800 to: 977889
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198258 to: 3198347
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437434 to: 3437523
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551303 to: 3551392
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804133 to: 804222
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 748 to: 837
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983693 to: 2983782
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051518 to: 1051607
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124378 to: 1124467
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124090 to: 1124179
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 748 to: 837
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803349 to: 2803438
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901841 to: 1901930
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336987 to: 337076
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362695 to: 3362784
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882116 to: 2882205
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274699 to: 3274788
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732253 to: 1732342
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650119 to: 2650208
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666551 to: 1666640
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245190 to: 3245279
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683207 to: 1683296
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611779 to: 1611868
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636059 to: 1636148
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240498 to: 3240587
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695400 to: 2695489
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420005 to: 1420094
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494505 to: 3494594
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987132 to: 987221
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729334 to: 2729423
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724804 to: 5724893
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972466 to: 972555
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695029 to: 2695118
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714443 to: 714532
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308534 to: 1308623
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1248301 to: 1248390
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4278102 to: 4278191
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1055729 to: 1055818
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 2 from: 1514178 to: 1514267
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279397 to: 3279486
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267820 to: 1267909
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446479 to: 1446568
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531418 to: 3531513
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940306 to: 940395
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1869300 to: 1869389
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172639 to: 2172734
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853359 to: 1853448
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628555 to: 628644
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164646 to: 3164735
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621723 to: 1621812
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877760 to: 3877849
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533785 to: 533880
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1358 to: 1447
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2074 to: 2163
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8236 to: 8325
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1466 to: 1555
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218239 to: 5218328
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241200 to: 2241289
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317786 to: 4317881
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218659 to: 2218748
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245166 to: 2245255
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388763 to: 1388852
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555387 to: 1555476
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990384 to: 2990473
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301623 to: 301718
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371639 to: 3371728
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080885 to: 3080974
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233777 to: 233866
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232502 to: 232591
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169633 to: 5169728
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480006 to: 1480095
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59184 to: 59273
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261551 to: 4261646
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968881 to: 968976
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140901 to: 4140990
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928798 to: 4928887
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40535 to: 40624
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597476 to: 4597565
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765844 to: 2765933
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921378 to: 2921467
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44908 to: 44997


Query-DNA-Entry-Section

Query-DNA-Def dare_048|beg|334|length|110|forward|gi
Query_DNA-Sequence
cgTcgtcgtaaccgcgaagtgccaccTactTacaaaaagacaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattcacccctgtgcatcccc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_051|beg|645|length|115|forward|gi
Query_DNA-Sequence
cgatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagTatttgctgaagataacTgcttacatcacaaatcgagttgaacaccaacaacgaag

Coding-DNA-Entry-Section

Coding-DNA
gatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaag
Protein-Sequence
MAKGDEVLTSGGLVGRITK
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057086 to: 1057142
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 749604 to: 749660
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542045 to: 2542101
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283943 to: 3283999
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267955 to: 3268011
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234649 to: 1234705
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1190351 to: 1190407
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 301341 to: 301397
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 802636 to: 802692
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 683955 to: 684011
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 253460 to: 253516
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 705405 to: 705461
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2490658 to: 2490714
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3694008 to: 3694064
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616746 to: 616802
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3435206 to: 3435262
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1426821 to: 1426877
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462754 to: 1462810
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555018 to: 2555074
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460327 to: 460383
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491244 to: 491300
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847911 to: 2847967
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400187 to: 400243
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976859 to: 976915
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443424 to: 443480
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391049 to: 391105
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494942 to: 494998
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441835 to: 441891
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356950 to: 357006
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426676 to: 426732
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426676 to: 426732
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11510 to: 11566
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501643 to: 501699
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 477 to: 533
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 895 to: 951
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356085 to: 356141
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203341 to: 203397
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491081 to: 491137
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410855 to: 2410911
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526703 to: 2526759
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506628 to: 506684
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491083 to: 491139
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6902 to: 6958
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316401 to: 316457
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316423 to: 316479
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412546 to: 412602
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1530 to: 1586
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1531 to: 1587
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205844 to: 2205900
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804324 to: 2804380
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336041 to: 336097
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274340 to: 1274396
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555724 to: 1555780
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129237 to: 129293
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900899 to: 1900955
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109194 to: 1109250
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635118 to: 1635174
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534808 to: 534864

Coding-DNA
gatggcaaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaag
Protein-Sequence
MAKGDEVLTSGGLVGRITK
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057086 to: 1057142
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 749604 to: 749660
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542045 to: 2542101
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283943 to: 3283999
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267955 to: 3268011
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234649 to: 1234705
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1190351 to: 1190407
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 301341 to: 301397
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 802636 to: 802692
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 683955 to: 684011
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 253460 to: 253516
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 705405 to: 705461
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2490658 to: 2490714
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3694008 to: 3694064
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616746 to: 616802
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3435206 to: 3435262
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1426821 to: 1426877
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462754 to: 1462810
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555018 to: 2555074
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460327 to: 460383
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491244 to: 491300
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847911 to: 2847967
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400187 to: 400243
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976859 to: 976915
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443424 to: 443480
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391049 to: 391105
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494942 to: 494998
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441835 to: 441891
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356950 to: 357006
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426676 to: 426732
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426676 to: 426732
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11510 to: 11566
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501643 to: 501699
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 477 to: 533
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 895 to: 951
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356085 to: 356141
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203341 to: 203397
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491081 to: 491137
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410855 to: 2410911
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526703 to: 2526759
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506628 to: 506684
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491083 to: 491139
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6902 to: 6958
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316401 to: 316457
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316423 to: 316479
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412546 to: 412602
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1530 to: 1586
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1531 to: 1587
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205844 to: 2205900
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804324 to: 2804380
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336041 to: 336097
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274340 to: 1274396
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555724 to: 1555780
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129237 to: 129293
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900899 to: 1900955
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109194 to: 1109250
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635118 to: 1635174
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534808 to: 534864


Query-DNA-Entry-Section

Query-DNA-Def dare_053|beg|1619|length|102|forward|gi
Query_DNA-Sequence
gagcttgccgggtgtacaagTatacagcgcgtgctaagaaatcttaggcgTcgaccgcaacccttgaatttcgtgaagtggacgataaagccgaccttgccg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_054|beg|1516|length|126|forward|gi
Query_DNA-Sequence
ctacgccTgttgagcagaacatcatattttgcgtaaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtacgtggtagagctgccgggtgtacaagatac

Coding-DNA-Entry-Section

Coding-DNA
tacgccTgttgagcagaacatcatattttgcgtaaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtacgtggtag
Protein-Sequence
TPVEQNIIFCVNRVNELGVAEPLVQRQGATRTW*S
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130203
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57055 to: 57141
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617711
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204903 to: 2204989
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145462
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44980 to: 45066


Query-DNA-Entry-Section

Query-DNA-Def dare_057|beg|271|length|115|forward|gi
Query_DNA-Sequence
tggaaagcattcgtaaagcatttgatgaagaccgttttgaccaatttgtTagccgagttctacgcgcgtTcgtaaccgcgaagtgccaccactacaaaaagacaaagcctgattt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_058|beg|1835|length|126|forward|gi
Query_DNA-Sequence
tcaaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgatTagcgaaggcggcaacaagatgtcagcgttctcgaaaaagaacattggcTaagTctgatggcgacggtgtttgccga

Coding-DNA-Entry-Section

Coding-DNA
caaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgat
Protein-Sequence
QSADEYGRPQVNISLD
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058280 to: 1058324
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617940 to: 617984
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755542 to: 755586
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439182 to: 439226
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204630 to: 2204674
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130432 to: 130476
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480252 to: 1480296
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401374 to: 401418
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902093 to: 1902131
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803148 to: 2803186
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145706 to: 1145744
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978052 to: 978090
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284856 to: 2284894
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110382 to: 1110426
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275528 to: 1275572

Coding-DNA
caaagcgccgacgaatatggtcgcccacaggtgaacatttcgctcgat
Protein-Sequence
QSADEYGRPQVNISLD
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058280 to: 1058324
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617940 to: 617984
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755542 to: 755586
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439182 to: 439226
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204630 to: 2204674
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130432 to: 130476
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480252 to: 1480296
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401374 to: 401418
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902093 to: 1902131
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803148 to: 2803186
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145706 to: 1145744
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978052 to: 978090
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284856 to: 2284894
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110382 to: 1110426
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275528 to: 1275572


Query-DNA-Entry-Section

Query-DNA-Def dare_059|beg|2348|length|106|forward|gi
Query_DNA-Sequence
atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaa

Coding-DNA-Entry-Section

Coding-DNA
atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcg
Protein-Sequence
MTLPGIAGIVLTVGMAVRCQRTDFRAYS
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 10 from: 1510 to: 1560
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 9 from: 288058 to: 288108
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 9 from: 797348 to: 797398
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058790 to: 1058840
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 3 from: 1514940 to: 1514990
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 337746 to: 337796
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 5 from: 1439105 to: 1439155
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1246504 to: 1246554
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 4 from: 1683960 to: 1684010
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 1902597 to: 1902647
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 5 from: 2889163 to: 2889213
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756052 to: 756102
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438666 to: 438716
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1184142 to: 1184192
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1612532 to: 1612582
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 2728620 to: 2728670
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 3 from: 1636812 to: 1636862
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204114 to: 2204164
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 960095 to: 960145
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 3 from: 5217513 to: 5217563
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 3 from: 3810359 to: 3810409
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 4 from: 3273985 to: 3274035
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 3 from: 1146210 to: 1146260
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 3 from: 1333311 to: 1333361
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540242 to: 1540292
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 3 from: 4143524 to: 4143574
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 4 from: 3493791 to: 3493841
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 3 from: 1072604 to: 1072654
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1504 to: 1554
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 1351 to: 1401
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 635 to: 685
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 3 from: 7513 to: 7563
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 3 from: 743 to: 793
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 3 from: 4596774 to: 4596824
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553510 to: 553560
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 188 to: 238
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618450 to: 618500
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130942 to: 130992
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217146 to: 1217196
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084354 to: 1084404
gi-nr: gi|34398108 gi_def: Porphyromonas gingivalis W83, complete genome hsp_num: 1 from: 1849643 to: 1849693
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621003 to: 1621053
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939583 to: 939633
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802632 to: 2802682
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804543 to: 1804593
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41288 to: 41338
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852639 to: 1852689
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268570 to: 1268620
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694683 to: 2694733
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420770 to: 1420820
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445756 to: 1445806
gi-nr: gi|109453537 gi_def: Roseobacter denitrificans OCh 114, complete genome hsp_num: 1 from: 2434534 to: 2434584
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069431 to: 1069481
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824763 to: 1824813
gi-nr: gi|56676665 gi_def: Silicibacter pomeroyi DSS-3, complete genome hsp_num: 1 from: 2456349 to: 2456399
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694309 to: 2694359
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240480 to: 2240530
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 58464 to: 58514
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217939 to: 2217989
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244446 to: 2244496
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3923135 to: 3923185
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 3 from: 3361981 to: 3362031
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 3305656 to: 3305706
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 2881402 to: 2881452
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1204808 to: 1204858
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1733006 to: 1733056
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 3000836 to: 3000886
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 2649405 to: 2649455
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1191750 to: 1191800
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1667304 to: 1667354
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237429 to: 3237479
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125311 to: 1125361
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13024 to: 13074
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7492 to: 7542
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922685 to: 1922735
gi-nr: gi|17739985 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 140 of 256 of the complete sequence hsp_num: 1 from: 4097 to: 4147
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1549425 to: 1549475
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 1 from: 1049215 to: 1049265
gi-nr: gi|85720936 gi_def: Syntrophus aciditrophicus SB, complete genome hsp_num: 1 from: 2261419 to: 2261469
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356854 to: 356904
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 1 from: 961118 to: 961168
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896539 to: 896589
gi-nr: gi|83755449 gi_def: Salinibacter ruber DSM 13855, complete genome hsp_num: 1 from: 2262676 to: 2262726
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 3 from: 1351 to: 1401
gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591906 to: 591956
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709727 to: 1709777
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 692441 to: 692491
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 631931 to: 631981
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1577224 to: 1577274
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996502 to: 1996552
gi-nr: gi|114339016 gi_def: Maricaulis maris MCS10, complete genome hsp_num: 1 from: 2076514 to: 2076564
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 1145496 to: 1145546
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244476 to: 3244526
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 1495 to: 1545
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 5064020 to: 5064070
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 3 from: 1480762 to: 1480812
gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1334559 to: 1334609
gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282820 to: 1282870
gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 1 from: 233350 to: 233400
gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144066 to: 144116
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 1237504 to: 1237554
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 3239784 to: 3239834
gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 797603 to: 797653
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284343 to: 2284393
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435445 to: 435495
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492838 to: 1492888
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309296 to: 1309346
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989673 to: 2989723
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987891 to: 987941
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44763 to: 44813
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877037 to: 3877087
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278674 to: 3278724
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377908 to: 3377958
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249063 to: 1249113
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277379 to: 4277429
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056488 to: 1056538
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165396 to: 3165446
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650997 to: 1651047
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695378 to: 2695428
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724081 to: 5724131
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577195 to: 577245
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156396 to: 156446
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131803 to: 2131853
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973225 to: 973275
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575536 to: 1575586
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389525 to: 1389575
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556149 to: 1556199
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401486 to: 401536
gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 2 from: 244260 to: 244310
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560720 to: 1560770
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598095 to: 1598145
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629576 to: 1629626
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208239 to: 1208289
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777355 to: 4777405
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268972 to: 1269022
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618818 to: 4618868
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224508 to: 4224558
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 2859094 to: 2859144
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257004 to: 3257054
gi-nr: gi|110279108 gi_def: Cytophaga hutchinsonii ATCC 33406, complete genome hsp_num: 1 from: 138931 to: 138981
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62992 to: 63042
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001432 to: 2001482
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 777465 to: 777515
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013800 to: 3013850
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869515 to: 1869565
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745366 to: 745416
gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8414 to: 8464
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939503 to: 1939553
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017510 to: 1017560
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549800 to: 549850
gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1210 to: 1260
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65066 to: 65116
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243439 to: 5243489
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78949 to: 78999
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 2 from: 2169217 to: 2169267
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043525 to: 1043575
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572037 to: 572087
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452919 to: 452969
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462319 to: 462369
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029139 to: 1029189
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534153 to: 1534203
gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553815 to: 2553865
gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521365 to: 2521415
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026554 to: 1026604
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094545 to: 3094595
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152903 to: 1152953
gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 28197 to: 28247
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384711 to: 384761
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056534 to: 2056584
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115866 to: 3115916
gi-nr: gi|24204616 gi_def: Leptospira interrogans serovar lai str. 56601 chromosome I, complete sequence hsp_num: 1 from: 1148354 to: 1148404
gi-nr: gi|45602555 gi_def: Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130, chromosome I, complete sequence hsp_num: 1 from: 3077024 to: 3077074
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1252531 to: 1252581
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 2 from: 200328 to: 200378
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081154 to: 1081204
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 1 from: 1384185 to: 1384235
gi-nr: gi|94549081 gi_def: Acidobacteria bacterium Ellin345, complete genome hsp_num: 1 from: 156006 to: 156056
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920571 to: 1920621
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209281 to: 209331
gi-nr: gi|50874889 gi_def: Desulfotalea psychrophila LSv54 chromosome hsp_num: 1 from: 909105 to: 909155
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496627 to: 1496677
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13811 to: 13861
gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 33907 to: 33957
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734846 to: 734896
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207085 to: 2207135
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10426 to: 10476
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841222 to: 1841272
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71993 to: 72043
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869379 to: 2869429
gi-nr: gi|58417290 gi_def: Ehrlichia ruminantium str. Welgevonden, complete genome hsp_num: 1 from: 1432636 to: 1432686
gi-nr: gi|58416339 gi_def: Ehrlichia ruminantium str. Gardel, complete genome hsp_num: 1 from: 1418858 to: 1418908
gi-nr: gi|57160810 gi_def: Ehrlichia ruminantium strain Welgevonden, complete genome hsp_num: 1 from: 1454867 to: 1454917
gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1540 to: 1590
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715199 to: 715249
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045599 to: 1045649
gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2814599 to: 2814649
gi-nr: gi|146152184 gi_def: Flavobacterium johnsoniae UW101, complete genome hsp_num: 2 from: 2720612 to: 2720662
gi-nr: gi|57236801 gi_def: Flavobacterium johnsoniae Mdh (mdh) gene, partial cds; SecDF (secDF) gene, complete cds; and hypothetical protein (fjo28) gene, partial cds hsp_num: 2 from: 2239 to: 2289
gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 1 from: 643098 to: 643148
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162605 to: 1162655
gi-nr: gi|146400702 gi_def: Acidiphilium cryptum JF-5, complete genome hsp_num: 1 from: 2187206 to: 2187256
gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359107 to: 1359157
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611214 to: 1611264
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503668 to: 1503718
gi-nr: gi|94554390 gi_def: Deinococcus geothermalis DSM 11300, complete genome hsp_num: 1 from: 1319033 to: 1319083
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244279 to: 1244329
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1729437 to: 1729487
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 1 from: 1129613 to: 1129663
gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64749 to: 64799
gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44809 to: 44859
gi-nr: gi|11612676 gi_def: Deinococcus radiodurans R1 chromosome 1, complete sequence hsp_num: 1 from: 1847884 to: 1847934
gi-nr: gi|147846875 gi_def: Synechococcus WH7803 complete genome sequence hsp_num: 1 from: 1255293 to: 1255343
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236349 to: 1236399
gi-nr: gi|78196017 gi_def: Synechococcus sp. CC9605, complete genome hsp_num: 1 from: 1115684 to: 1115734
gi-nr: gi|78167878 gi_def: Synechococcus sp. CC9902, complete genome hsp_num: 1 from: 1239593 to: 1239643
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557434 to: 1557484
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834673 to: 1834723
gi-nr: gi|84785911 gi_def: Erythrobacter litoralis HTCC2594, complete genome hsp_num: 1 from: 743822 to: 743872
gi-nr: gi|33634491 gi_def: Prochlorococcus marinus MIT9313 complete genome; segment 2/7 hsp_num: 1 from: 322073 to: 322123
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401946 to: 2401996
gi-nr: gi|37508091 gi_def: Gloeobacter violaceus PCC 7421 DNA, complete genome hsp_num: 1 from: 4365264 to: 4365314
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122499 to: 122549
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833414 to: 833464
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241379 to: 1241429
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 1602595 to: 1602645
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1066137 to: 1066187
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636757 to: 1636807
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515267 to: 1515317
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5879053 to: 5879103
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804384 to: 1804434
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2213065 to: 2213115
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883605 to: 1883655
gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660974 to: 661024
gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331519 to: 331569
gi-nr: gi|56387602 gi_def: Anaplasma marginale str. St. Maries, complete genome hsp_num: 1 from: 1109995 to: 1110045
gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4537 to: 4587

Coding-DNA
atgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggTtcgatgccaacgtactgattttcgagcgtattcgtgaag
Protein-Sequence
ALHEYARKSVRWHRTAIPTVNTIPAIPGKV
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1058792 to: 1058839
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514942 to: 1514989
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337748 to: 337795
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683962 to: 1684009
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 5 from: 1246506 to: 1246553
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 756054 to: 756101
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 3 from: 438667 to: 438714
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612534 to: 1612581
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728621 to: 2728668
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636814 to: 1636861
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204115 to: 2204162
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217514 to: 5217561
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273986 to: 3274033
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3810360 to: 3810407
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1146212 to: 1146259
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333312 to: 1333359
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 2 from: 1540244 to: 1540291
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493792 to: 3493839
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4143525 to: 4143572
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072605 to: 1072652
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1352 to: 1399
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 636 to: 683
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7514 to: 7561
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 744 to: 791
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596775 to: 4596822
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 190 to: 237
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618452 to: 618499
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130944 to: 130991
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217147 to: 1217194
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084355 to: 1084402
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1621004 to: 1621051
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 939584 to: 939631
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 41290 to: 41337
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 2 from: 1852640 to: 1852687
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1268572 to: 1268619
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694684 to: 2694731
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 2 from: 1420772 to: 1420819
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 2 from: 1445757 to: 1445804
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 2 from: 1069433 to: 1069480
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824765 to: 1824812
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 2 from: 2694310 to: 2694357
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2240481 to: 2240528
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58465 to: 58512
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2217940 to: 2217987
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2244447 to: 2244494
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361982 to: 3362029
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 4 from: 3923136 to: 3923183
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881403 to: 2881450
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 4 from: 3305657 to: 3305704
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733008 to: 1733055
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 4 from: 1204810 to: 1204857
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649406 to: 2649453
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667306 to: 1667353
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 4 from: 1191752 to: 1191799
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125312 to: 1125359
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 2 from: 13026 to: 13073
gi-nr: gi|17739985 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 140 of 256 of the complete sequence hsp_num: 2 from: 4098 to: 4145
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 2 from: 1549426 to: 1549473
gi-nr: gi|88862040 gi_def: Jannaschia sp. CCS1, complete genome hsp_num: 2 from: 1049217 to: 1049264
gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 4420636 to: 4420683
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692442 to: 692489
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631932 to: 631979
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 3 from: 3244477 to: 3244524
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145498 to: 1145545
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1497 to: 1544
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480770 to: 1480811
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239785 to: 3239832
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 4 from: 1237506 to: 1237553
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284344 to: 2284391
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 2 from: 435446 to: 435493
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492839 to: 1492886
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 2 from: 2989674 to: 2989721
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44764 to: 44811
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278675 to: 3278722
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377910 to: 3377957
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650998 to: 1651045
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156397 to: 156444
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 2 from: 2131804 to: 2131851
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575538 to: 1575585
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389527 to: 1389574
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556151 to: 1556198
gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244262 to: 244309
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560721 to: 1560768
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598097 to: 1598144
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629577 to: 1629624
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618819 to: 4618866
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224509 to: 4224556
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 2 from: 2859095 to: 2859142
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 2 from: 78950 to: 78997
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169219 to: 2169266
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043526 to: 1043573
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572039 to: 572086
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029140 to: 1029187
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026555 to: 1026602
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152904 to: 1152951
gi-nr: gi|119372524 gi_def: Paracoccus denitrificans PD1222 chromosome 1, complete genome hsp_num: 3 from: 668427 to: 668459
gi-nr: gi|146152184 gi_def: Flavobacterium johnsoniae UW101, complete genome hsp_num: 1 from: 2720614 to: 2720661
gi-nr: gi|57236801 gi_def: Flavobacterium johnsoniae Mdh (mdh) gene, partial cds; SecDF (secDF) gene, complete cds; and hypothetical protein (fjo28) gene, partial cds hsp_num: 1 from: 2241 to: 2288
gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 2 from: 643100 to: 643147
gi-nr: gi|149770655 gi_def: Flavobacterium psychrophilum JIP02/86 complete genome hsp_num: 3 from: 1309713 to: 1309754
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 2 from: 1129614 to: 1129661


Query-DNA-Entry-Section

Query-DNA-Def dare_060|beg|2663|length|119|forward|gi
Query_DNA-Sequence
ggcaaacgtatcaacaaactgtcTgatctgaggctggggtaagttatgtttcaaatcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcccttcgccttgtcgc

Coding-DNA-Entry-Section

Coding-DNA
atcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc
Protein-Sequence
MFQILKADKMIDFMRWSKFA
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438298 to: 438378
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756390 to: 756470
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131298 to: 131357

Coding-DNA
atcctaaaagcagacaaaatgatcgactttatgcgttggtcgaaattcgcc
Protein-Sequence
MFQILKADKMIDFMRWSKFA
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438298 to: 438378
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756390 to: 756470
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131298 to: 131357


Query-DNA-Entry-Section

Query-DNA-Def dare_061|beg|697|length|108|forward|gi
Query_DNA-Sequence
ccacaagTattgctgaagataacgcttacTatcacaatcgaagttgaacaccaacaacgaagttgtgtcaagaaggaTcttcgtgactgcagtgctaccaaaaTggta

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_062|beg|2459|length|109|forward|gi
Query_DNA-Sequence
cagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaTccaccttaattacggcgatcattttgtttgccgttggtacaggggcg

Coding-DNA-Entry-Section

Coding-DNA
agcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaTccaccttaattacggcgatcattttgtttgccgttggtacaggggcg
Protein-Sequence
QQAIHQGYANAFSTIADANIIHLNYGDHFVCRWYRG
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756163 to: 756231
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618561 to: 618629
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438605
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204053
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 299 to: 367
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131053 to: 131121
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361861 to: 3361920
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273865 to: 3273924
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667415 to: 1667474
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684071 to: 1684130
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733117 to: 1733176
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612643 to: 1612702
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881282 to: 2881341
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493671 to: 3493730
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244356 to: 3244415
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728500 to: 2728559
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694563 to: 2694622
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636923 to: 1636982
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649285 to: 2649344
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239664 to: 3239723
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480873 to: 1480932
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629469


Query-DNA-Entry-Section

Query-DNA-Def dare_063|beg|1638|length|131|forward|gi
Query_DNA-Sequence
atacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaatcaagttcgatc

Coding-DNA-Entry-Section

Coding-DNA
tacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaa
Protein-Sequence
*FRCHRRTSCCRSGKGRLYRPLHENSRVAVAPKIFFSTRC
Hit-Information Section
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5745202 to: 5745270
gi-nr: gi|66934576 gi_def: Pseudomonas viridiflava strain RMX23.1a pectate lyase gene, complete cds hsp_num: 1 from: 707 to: 742
gi-nr: gi|46125758 gi_def: Gibberella zeae PH-1 chromosome 4 hypothetical protein (FG07257.1) partial mRNA hsp_num: 2 from: 407 to: 442
gi-nr: gi|90954574 gi_def: Uncultured sulfate-reducing bacterium partial dsrAB gene for sulfite reductase, dissimilatory-type alpha subunit, clone 3c_20 hsp_num: 1 from: 626 to: 685
gi-nr: gi|6460827 gi_def: Deinococcus radiodurans R1 plasmid MP1, complete sequence hsp_num: 1 from: 38520 to: 38570

Coding-DNA
tacagcgcgtgctaaagaaaatcttaggcgcgaccgcaacccttgaattttcgtgaagtggacgataaagccgaccTttgccgctgcggcagcaggacgtgcgcctgtggcagcgaaa
Protein-Sequence
*FRCHRRTSCCRSGKGRLYRPLHENSRVAVAPKIFFSTRC
Hit-Information Section
gi-nr: gi|118168627 gi_def: Mycobacterium smegmatis str. MC2 155, complete genome hsp_num: 1 from: 5745202 to: 5745270
gi-nr: gi|66934576 gi_def: Pseudomonas viridiflava strain RMX23.1a pectate lyase gene, complete cds hsp_num: 1 from: 707 to: 742
gi-nr: gi|46125758 gi_def: Gibberella zeae PH-1 chromosome 4 hypothetical protein (FG07257.1) partial mRNA hsp_num: 2 from: 407 to: 442
gi-nr: gi|90954574 gi_def: Uncultured sulfate-reducing bacterium partial dsrAB gene for sulfite reductase, dissimilatory-type alpha subunit, clone 3c_20 hsp_num: 1 from: 626 to: 685
gi-nr: gi|6460827 gi_def: Deinococcus radiodurans R1 plasmid MP1, complete sequence hsp_num: 1 from: 38520 to: 38570


Query-DNA-Entry-Section

Query-DNA-Def dare_064|beg|2186|length|133|forward|gi
Query_DNA-Sequence
cagaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggtaatgctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatcat

Coding-DNA-Entry-Section

Coding-DNA
agaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggta
Protein-Sequence
EYRYGYSWPVFGVWWR*C
Hit-Information Section

Coding-DNA
ctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatc
Protein-Sequence
CCFTVLYYRKFGMIANIALMANLVLI
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438821
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755947 to: 756018
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058685 to: 1058756
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618345 to: 618416
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204269
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287953 to: 288024
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56350 to: 56421
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1399 to: 1470
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110787 to: 1110858
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1461 to: 1532
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511552 to: 3511623
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197625 to: 3197696
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550670 to: 3550741
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804784 to: 804855
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983060 to: 2983131
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052169 to: 1052240
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125029 to: 1125100
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124741 to: 1124812
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170830 to: 1170901
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846303 to: 2846374
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694767 to: 2694838

Coding-DNA
agaatatcgatatgggtattcaTggcctgtatttggggtatggtggcggta
Protein-Sequence
EYRYGYSWPVFGVWWR*C
Hit-Information Section

Coding-DNA
ctgTtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatc
Protein-Sequence
CCFTVLYYRKFGMIANIALMANLVLI
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438821
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755947 to: 756018
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058685 to: 1058756
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618345 to: 618416
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204269
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287953 to: 288024
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56350 to: 56421
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1399 to: 1470
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110787 to: 1110858
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1461 to: 1532
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511552 to: 3511623
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197625 to: 3197696
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550670 to: 3550741
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804784 to: 804855
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983060 to: 2983131
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052169 to: 1052240
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125029 to: 1125100
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124741 to: 1124812
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170830 to: 1170901
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846303 to: 2846374
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694767 to: 2694838


Query-DNA-Entry-Section

Query-DNA-Def dare_065|beg|2163|length|136|forward|gi
Query_DNA-Sequence
ccattggtccatcaatgggtcagTcaTgaatatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaat

Coding-DNA-Entry-Section

Coding-DNA
tatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcacta
Protein-Sequence
ISIWVFRPVFGVLVAVMLFTVLYYRKFGMIANIAL
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755929 to: 755997
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438771 to: 438839
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058667 to: 1058735
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618327 to: 618395
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287935 to: 288003
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56371 to: 56439
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125472
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1482 to: 1559
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694788 to: 2694856

Coding-DNA
tatcgatatgggtattcaggcctgtatttggggtatTggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcacta
Protein-Sequence
ISIWVFRPVFGVLVAVMLFTVLYYRKFGMIANIAL
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755929 to: 755997
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438771 to: 438839
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058667 to: 1058735
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618327 to: 618395
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287935 to: 288003
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56371 to: 56439
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125472
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1482 to: 1559
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694788 to: 2694856


Query-DNA-Entry-Section

Query-DNA-Def dare_066|beg|2422|length|128|forward|gi
Query_DNA-Sequence
gcgtattcgtgaagagtacgTcgaaggaaaaaatccTgcTagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatcattttgt

Coding-DNA-Entry-Section

Coding-DNA
aagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatca
Protein-Sequence
QAIHQGYANAFSTIADANITTLNYGDH
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058969
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438602
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756231
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618629
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204050
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 367
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694631
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131121
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493739
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361929
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881350
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728568
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273933
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733108 to: 1733182
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667406 to: 1667480
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244424
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684062 to: 1684136
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612634 to: 1612708
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636914 to: 1636988
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649353
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284214 to: 2284294
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239732
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511339 to: 3511404
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197412 to: 3197477
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550457 to: 3550522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805068
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1683
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982847 to: 2982912
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052453
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125313
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125025
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436588 to: 3436653
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13387
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205218
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409034 to: 2409099
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524882 to: 2524947
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508505
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1683
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420949
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902711 to: 1902776
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694180 to: 2694242
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852510 to: 1852572

Coding-DNA
aagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaaattacggcgatca
Protein-Sequence
QAIHQGYANAFSTIADANITTLNYGDH
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058969
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438537 to: 438602
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756231
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618629
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203985 to: 2204050
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 367
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694631
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131121
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493739
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361929
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881350
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728568
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273933
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733108 to: 1733182
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667406 to: 1667480
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244424
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684062 to: 1684136
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612634 to: 1612708
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636914 to: 1636988
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649353
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284214 to: 2284294
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239732
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511339 to: 3511404
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197412 to: 3197477
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550457 to: 3550522
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805068
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1683
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982847 to: 2982912
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052453
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125313
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125025
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3436588 to: 3436653
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13387
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205218
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409034 to: 2409099
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524882 to: 2524947
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508505
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1683
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420949
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902711 to: 1902776
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694180 to: 2694242
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852510 to: 1852572


Query-DNA-Entry-Section

Query-DNA-Def dare_068|beg|1719|length|142|forward|gi
Query_DNA-Sequence
cTtgcggcTagcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaagcTgcgtgattctgggtggttcaacattaTccgatgcTaagctcaagcgccgacgaatatggt

Coding-DNA-Entry-Section

Coding-DNA
gcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaag
Protein-Sequence
*QDVRLLAAKSSSYRNGRPVVLKK
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204717 to: 2204746

Coding-DNA
gcaggacgtgcgcctgctggcagcgaaatcaagttcgTatcgtaatggtcgtcctgtggtgctgaaaaag
Protein-Sequence
*QDVRLLAAKSSSYRNGRPVVLKK
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204717 to: 2204746


Query-DNA-Entry-Section

Query-DNA-Def dare_070|beg|2756|length|114|forward|gi
Query_DNA-Sequence
cgaaaattcgccttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctcaactgggggctggatttcacgggcggtactttgattgaagtg

Coding-DNA-Entry-Section

Coding-DNA
gaaaattcgccttcgccttgtcgctggtgatgattgccgcatcgatttttactctgtctaccaagtggctcaactgggggctggatttcacgggcggtactttgattgaagtg
Protein-Sequence
RKFAFALSLVMIAASIFTLSTKWLNWGLDFTGGTLIEV
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288468 to: 288578
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438196 to: 438306
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756462 to: 756572
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1059200 to: 1059310
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618860 to: 618970
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203646 to: 2203756
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131349 to: 131459


Query-DNA-Entry-Section

Query-DNA-Def dare_071|beg|1265|length|131|forward|gi
Query_DNA-Sequence
atggaaaaatttggtcagccaacaagaagaagctttccgcagtgatctgcTgtgacgagaaaattcgttaccgcgcgatccgtccatttatcggatgcggttgaagtgaccctgcgtgatgccgaTgcagc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_074|beg|245|length|133|forward|gi
Query_DNA-Sequence
taacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctTacgcgTcgtcgtaaccgcgaagtgccTaccactacaaaaagacaa

Coding-DNA-Entry-Section

Coding-DNA
aacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttc
Protein-Sequence
TCVTYQRLMESIRKAIDEDRFDQFVAEF
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056630 to: 1056701
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616305 to: 616376
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440745 to: 440816
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753952 to: 754023
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393415 to: 2393486
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156590 to: 1156661

Coding-DNA
aacctgcgttactTaccaacgcttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttc
Protein-Sequence
TCVTYQRLMESIRKAIDEDRFDQFVAEF
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056630 to: 1056701
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616305 to: 616376
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440745 to: 440816
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753952 to: 754023
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393415 to: 2393486
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156590 to: 1156661


Query-DNA-Entry-Section

Query-DNA-Def dare_075|beg|2172|length|111|forward|gi
Query_DNA-Sequence
catcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaTctaccgtaagtttggcatgattgc

Coding-DNA-Entry-Section

Coding-DNA
atcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaT
Protein-Sequence
HQWVSMNIDMGIQACIWGMVAVMLFTVLY
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287899 to: 287967
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 797189 to: 797257
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 1351 to: 1419
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058631 to: 1058699
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438807 to: 438875
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755893 to: 755961
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618291 to: 618359
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130783 to: 130851

Coding-DNA
atcaatgggtcagcaTgaatatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttaT
Protein-Sequence
HQWVSMNIDMGIQACIWGMVAVMLFTVLY
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287899 to: 287967
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 797189 to: 797257
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 1351 to: 1419
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058631 to: 1058699
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438807 to: 438875
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755893 to: 755961
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618291 to: 618359
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130783 to: 130851


Query-DNA-Entry-Section

Query-DNA-Def dare_077|beg|1719|length|118|forward|gi
Query_DNA-Sequence
ctgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaagcattaccgatgcaagc

Coding-DNA-Entry-Section

Coding-DNA
tgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaa
Protein-Sequence
CLEPPRITRFFSTTGRPLRSNLISLPAGARPACR
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 796726 to: 796818
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 888 to: 980
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287436 to: 287528
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204694 to: 2204783
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058171 to: 1058254
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439246 to: 439335
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755433 to: 755522
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617831 to: 617920

Coding-DNA
tgcggcaTgcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcTaa
Protein-Sequence
CLEPPRITRFFSTTGRPLRSNLISLPAGARPACR
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 796726 to: 796818
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 3 from: 888 to: 980
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287436 to: 287528
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204694 to: 2204783
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058171 to: 1058254
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439246 to: 439335
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755433 to: 755522
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617831 to: 617920


Query-DNA-Entry-Section

Query-DNA-Def dare_079|beg|78|length|115|forward|gi
Query_DNA-Sequence
tttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgactggttacacttTgcaaaaattattcgTaagtcatacc

Coding-DNA-Entry-Section

Coding-DNA
ttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgac
Protein-Sequence
FVTGGVIKIRNAAHKTDTTPLDPHCD
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440919 to: 440996
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753772 to: 753849
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056450 to: 1056527
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616125 to: 616202
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128751 to: 128828
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206379 to: 2206456
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478528 to: 1478605
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399703 to: 399780

Coding-DNA
ttgtgacgggtggtgtgatcaagatccgtaatgcagcacataaaaccgatacaacaccactggatcctcattgcgac
Protein-Sequence
FVTGGVIKIRNAAHKTDTTPLDPHCD
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440919 to: 440996
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753772 to: 753849
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056450 to: 1056527
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616125 to: 616202
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128751 to: 128828
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206379 to: 2206456
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478528 to: 1478605
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399703 to: 399780


Query-DNA-Entry-Section

Query-DNA-Def dare_083|beg|1468|length|109|forward|gi
Query_DNA-Sequence
tgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcaTctattttgcgtTaaccgggtgaacgaactgggtgtTg

Coding-DNA-Entry-Section

Coding-DNA
gtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcaT
Protein-Sequence
VLVAKFTEARLQEIRNYAVEQNII
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130063 to: 130131
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439527 to: 439592
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755176 to: 755241
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057914 to: 1057979
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617574 to: 617639
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204975 to: 2205040


Query-DNA-Entry-Section

Query-DNA-Def dare_086|beg|2367|length|127|forward|gi
Query_DNA-Sequence
ctggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaagTcgatttcatcaaggttacgctaa

Coding-DNA-Entry-Section

Coding-DNA
tggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaa
Protein-Sequence
LVIVLTVGMAVDANVTDFRALFREELREGKNPQQ
Hit-Information Section
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 269 to: 304
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756133 to: 756168
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438600 to: 438635
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204048 to: 2204083
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480843 to: 1480878
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 131023 to: 131058
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176414 to: 176452
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63229 to: 63267
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45293 to: 45331

Coding-DNA
tggtTatcgtgttgacggtcggtatggcggtcgatgccaacgtTactgattttcgagcgTtaTttcgtgaagagctacgcgaaggaaaaaatccgcagcaa
Protein-Sequence
LVIVLTVGMAVDANVTDFRALFREELREGKNPQQ
Hit-Information Section
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 269 to: 304
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756133 to: 756168
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438600 to: 438635
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204048 to: 2204083
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1480843 to: 1480878
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 131023 to: 131058
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176414 to: 176452
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63229 to: 63267
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45293 to: 45331


Query-DNA-Entry-Section

Query-DNA-Def dare_090|beg|2770|length|116|forward|gi
Query_DNA-Sequence
gccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTgggggctggatttcacgggcggtacTtttgattgaagtgggcttttgaacagc

Coding-DNA-Entry-Section

Coding-DNA
ccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTggggg
Protein-Sequence
LVAGDDCRIDFLLCLPSGSTWG
Hit-Information Section
gi-nr: gi|109703867 gi_def: Synthetic construct Vibrio cholerae clone FLH175184.01F secF-1 gene, complete sequence hsp_num: 3 from: 95 to: 130

Coding-DNA
ccttgtcgctggtgatgattgccgcatcgattttttactctgtctaccaagtggctcaactTggggg
Protein-Sequence
LVAGDDCRIDFLLCLPSGSTWG
Hit-Information Section
gi-nr: gi|109703867 gi_def: Synthetic construct Vibrio cholerae clone FLH175184.01F secF-1 gene, complete sequence hsp_num: 3 from: 95 to: 130


Query-DNA-Entry-Section

Query-DNA-Def dare_094|beg|29|length|101|forward|gi
Query_DNA-Sequence
catgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgtTaatgcagcacataaaaccgata

Coding-DNA-Entry-Section

Coding-DNA
atgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgt
Protein-Sequence
HVDCVMPTRNARNGHLFVTGGVIKIR
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 285746 to: 285817
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056408 to: 1056479
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440967 to: 441038
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753730 to: 753801
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616083 to: 616154
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128709 to: 128780
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206427 to: 2206498
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168705 to: 1168776
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555529 to: 2555600
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459801 to: 459872
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490718 to: 490789
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513760 to: 3513831
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399661 to: 399732
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976333 to: 976404
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199833 to: 3199904
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439019 to: 3439090
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442898 to: 442969
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552878 to: 3552949
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802576 to: 802647
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390523 to: 390594
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494416 to: 494487
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 790 to: 861
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478486 to: 1478557
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985268 to: 2985339
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049961 to: 1050032
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122821 to: 1122892
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441309 to: 441380
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356424 to: 356495
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108669 to: 1108740
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426150 to: 426221
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426150 to: 426221
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10984 to: 11055
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501117 to: 501188
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355559 to: 355630
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122533 to: 1122604
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273709 to: 1273780
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58532 to: 58603
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202815 to: 202886
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490555 to: 490626
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411366 to: 2411437
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527214 to: 2527285
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506102 to: 506173
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490557 to: 490628
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6376 to: 6447
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316912 to: 316983
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315897 to: 315968
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412020 to: 412091
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1004 to: 1075
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1005 to: 1076
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334989 to: 335060
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848421 to: 2848492
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156812 to: 1156883
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728403 to: 728474
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352370 to: 352441
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554293 to: 1554364
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271876 to: 271947
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335505 to: 335576
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139943 to: 140014
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139453 to: 139524
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696990 to: 2697061
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627094 to: 627165
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496000 to: 3496071
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804873 to: 2804944
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831861 to: 831932
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900336 to: 1900407
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246768 to: 1246839
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505969 to: 1506040
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279653 to: 4279724
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117097 to: 1117168
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3838 to: 3909
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143626 to: 1143697
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307001 to: 1307072
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985599 to: 985670
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054196 to: 1054267
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970933 to: 971004
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879314 to: 3879385
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551080 to: 551151
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364178 to: 3364249
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883600 to: 2883671
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730840 to: 2730911
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276182 to: 3276253
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730787 to: 1730858
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651606 to: 2651677
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246672 to: 3246743
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681742 to: 1681813
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634592 to: 1634663
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2924 to: 2995
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3639 to: 3710
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3640 to: 3711
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9802 to: 9873
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3032 to: 3103
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822751 to: 1822822
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219795 to: 5219866
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696537 to: 2696608
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726365 to: 5726436
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 39 to: 110
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553841 to: 1553912
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280946 to: 3281017
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387216 to: 1387287
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827102 to: 827173
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091266 to: 1091337
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161629 to: 1161700
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829003 to: 829074
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130277 to: 1130348
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 793 to: 864
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 871 to: 942
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825347 to: 825418
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130326 to: 1130397
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267331 to: 267402
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481714 to: 481785
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864236 to: 1864295
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393723
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108364 to: 2108417
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 39143 to: 39214
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889562 to: 889633

Coding-DNA
atgttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtgacgggtggtgtgatcaagatccgt
Protein-Sequence
HVDCVMPTRNARNGHLFVTGGVIKIR
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 285746 to: 285817
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056408 to: 1056479
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440967 to: 441038
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753730 to: 753801
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616083 to: 616154
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128709 to: 128780
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206427 to: 2206498
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168705 to: 1168776
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555529 to: 2555600
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459801 to: 459872
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490718 to: 490789
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513760 to: 3513831
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399661 to: 399732
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976333 to: 976404
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199833 to: 3199904
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439019 to: 3439090
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442898 to: 442969
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552878 to: 3552949
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802576 to: 802647
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390523 to: 390594
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494416 to: 494487
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 790 to: 861
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478486 to: 1478557
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985268 to: 2985339
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049961 to: 1050032
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122821 to: 1122892
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441309 to: 441380
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356424 to: 356495
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108669 to: 1108740
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426150 to: 426221
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426150 to: 426221
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10984 to: 11055
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501117 to: 501188
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355559 to: 355630
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122533 to: 1122604
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273709 to: 1273780
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58532 to: 58603
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202815 to: 202886
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490555 to: 490626
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411366 to: 2411437
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527214 to: 2527285
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506102 to: 506173
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490557 to: 490628
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6376 to: 6447
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316912 to: 316983
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315897 to: 315968
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412020 to: 412091
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1004 to: 1075
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1005 to: 1076
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334989 to: 335060
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848421 to: 2848492
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156812 to: 1156883
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728403 to: 728474
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352370 to: 352441
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554293 to: 1554364
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271876 to: 271947
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335505 to: 335576
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139943 to: 140014
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139453 to: 139524
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696990 to: 2697061
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627094 to: 627165
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496000 to: 3496071
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804873 to: 2804944
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831861 to: 831932
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900336 to: 1900407
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246768 to: 1246839
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505969 to: 1506040
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279653 to: 4279724
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117097 to: 1117168
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3838 to: 3909
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143626 to: 1143697
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1307001 to: 1307072
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985599 to: 985670
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054196 to: 1054267
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970933 to: 971004
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879314 to: 3879385
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551080 to: 551151
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364178 to: 3364249
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883600 to: 2883671
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730840 to: 2730911
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276182 to: 3276253
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730787 to: 1730858
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651606 to: 2651677
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246672 to: 3246743
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681742 to: 1681813
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634592 to: 1634663
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2924 to: 2995
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3639 to: 3710
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3640 to: 3711
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9802 to: 9873
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3032 to: 3103
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822751 to: 1822822
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219795 to: 5219866
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696537 to: 2696608
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726365 to: 5726436
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 39 to: 110
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553841 to: 1553912
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280946 to: 3281017
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387216 to: 1387287
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827102 to: 827173
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091266 to: 1091337
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161629 to: 1161700
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829003 to: 829074
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130277 to: 1130348
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 793 to: 864
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 871 to: 942
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825347 to: 825418
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130326 to: 1130397
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267331 to: 267402
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481714 to: 481785
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864236 to: 1864295
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393723
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108364 to: 2108417
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 39143 to: 39214
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889562 to: 889633


Query-DNA-Entry-Section

Query-DNA-Def dare_100|beg|2179|length|123|forward|gi
Query_DNA-Sequence
gggtcagcagaatatcgatatgggtattcaggcctTgtatttggggtatggtggcggtaatgctgtttacggtttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcg

Coding-DNA-Entry-Section

Coding-DNA
ggtcagcagaatatcgatatgggtattcaggcctTgtatttggggtatggtggcggta
Protein-Sequence
GSAEYRYGYSGLVFGVWWR*C
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1376 to: 1414
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797214 to: 797252
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287924 to: 287962
gi-nr: gi|71993102 gi_def: Caenorhabditis elegans K04C1.3 (K04C1.3) mRNA, complete cds hsp_num: 1 from: 485 to: 511

Coding-DNA
ctgtttacggtttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcg
Protein-Sequence
CCLRFLYYRKFGMIANIALMA
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1376 to: 1414
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755956 to: 756003
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438765 to: 438812
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797214 to: 797252
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058694 to: 1058741
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618354 to: 618401
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287924 to: 287962
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 287962 to: 288009
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694832
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1476 to: 1523


Query-DNA-Entry-Section

Query-DNA-Def dare_101|beg|1165|length|119|forward|gi
Query_DNA-Sequence
ccatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaattggtcagccaa

Coding-DNA-Entry-Section

Coding-DNA
catattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaat
Protein-Sequence
PYWLESIGAAPMKLGLDLRGGVHFLMEVDMDAAMEN
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439797 to: 439901
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754867 to: 754971
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129760 to: 129864
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057605 to: 1057709
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617265 to: 617369
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205248 to: 2205349
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479589 to: 1479690
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109716 to: 1109817
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285465 to: 2285566
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803763 to: 2803864
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512593 to: 3512694
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198666 to: 3198767
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376678 to: 3376779
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551711 to: 3551812
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803713 to: 803814
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 328 to: 429
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984101 to: 2984202
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051098 to: 1051199
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123958 to: 1124059
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123670 to: 1123771
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882530 to: 2882631
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666125 to: 1666226
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1682781 to: 1682882
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3363109 to: 3363210
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3275113 to: 3275214
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267391 to: 1267492
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245604 to: 3245705
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901415 to: 1901516
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695443 to: 2695547
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40112 to: 40219
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 328 to: 429
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766264 to: 2766365
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46397 to: 46468
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888297 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64333 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177518 to: 177589
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12622

Coding-DNA
catattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtggatatggatgccgcgatggaaaat
Protein-Sequence
PYWLESIGAAPMKLGLDLRGGVHFLMEVDMDAAMEN
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439797 to: 439901
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754867 to: 754971
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129760 to: 129864
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057605 to: 1057709
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617265 to: 617369
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205248 to: 2205349
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479589 to: 1479690
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109716 to: 1109817
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285465 to: 2285566
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803763 to: 2803864
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512593 to: 3512694
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198666 to: 3198767
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376678 to: 3376779
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551711 to: 3551812
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803713 to: 803814
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 328 to: 429
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984101 to: 2984202
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051098 to: 1051199
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123958 to: 1124059
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123670 to: 1123771
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882530 to: 2882631
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666125 to: 1666226
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1682781 to: 1682882
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3363109 to: 3363210
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3275113 to: 3275214
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267391 to: 1267492
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245604 to: 3245705
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901415 to: 1901516
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695443 to: 2695547
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40112 to: 40219
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 328 to: 429
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766264 to: 2766365
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46397 to: 46468
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888297 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64333 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177518 to: 177589
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12622


Query-DNA-Entry-Section

Query-DNA-Def dare_102|beg|3|length|137|forward|gi
Query_DNA-Sequence
gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccgtaatgcagcactaaaaccgatacaacaccact

Coding-DNA-Entry-Section

Coding-DNA
gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccg
Protein-Sequence
VEGVRRGIDMFDCVMPTRNARNGHLFVDGWCDQDP
Hit-Information Section
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 4 from: 843 to: 878
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206531
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056375 to: 1056461
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616050 to: 616136
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128676 to: 128762
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58556 to: 58636
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 971 to: 1051
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 972 to: 1052
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 757 to: 837
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6343 to: 6423
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202782 to: 202862
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10951 to: 11031
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1306968 to: 1307051
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985566 to: 985649
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879335 to: 3879418
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246735 to: 1246818
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279674 to: 4279757
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054163 to: 1054246
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970900 to: 970983
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2945 to: 3028
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3660 to: 3743
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3661 to: 3744
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9823 to: 9906
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3053 to: 3136
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219816 to: 5219899
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726386 to: 5726469
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 60 to: 143
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553808 to: 1553891
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139420 to: 139500
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280967 to: 3281050
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108331 to: 2108426
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512598 to: 1512681
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143593 to: 1143676
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387183 to: 1387266
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168672 to: 1168752
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555553 to: 2555633
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459768 to: 459848
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490685 to: 490765
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335013 to: 335093
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848445 to: 2848525
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513784 to: 3513864
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399628 to: 399708
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156836 to: 1156916
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728427 to: 728507
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352337 to: 352417
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976300 to: 976380
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199857 to: 3199937
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831885 to: 831965
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439043 to: 3439123
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442865 to: 442945
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552902 to: 3552982
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505993 to: 1506073
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802543 to: 802623
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390490 to: 390570
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494383 to: 494463
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985292 to: 2985372
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049928 to: 1050008
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122788 to: 1122868
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441276 to: 441356
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356391 to: 356471
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554260 to: 1554340
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864203 to: 1864298
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3862 to: 3942
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108636 to: 1108716
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426117 to: 426197
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426117 to: 426197
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501084 to: 501164
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355526 to: 355606
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122500 to: 1122580
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490522 to: 490602
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411390 to: 2411470
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527238 to: 2527318
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506069 to: 506149
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117064 to: 1117144
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271900 to: 271980
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490524 to: 490604
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316936 to: 317016
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315864 to: 315944
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 411987 to: 412067
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627061 to: 627141
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478453 to: 1478533
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273676 to: 1273756
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697017 to: 2697094
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665053 to: 1665130
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900303 to: 1900380
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681709 to: 1681786
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610281 to: 1610358
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3242008 to: 3242085
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496027 to: 3496104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364205 to: 3364282
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2991998 to: 2992075
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883627 to: 2883704
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804900 to: 2804977
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730867 to: 2730944
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276209 to: 3276286
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730754 to: 1730831
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651633 to: 2651710
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246699 to: 3246776
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634559 to: 1634636
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139910 to: 139990
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335472 to: 335552
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2356524 to: 2356604
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551047 to: 551127
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696641
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393756
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163028 to: 3163105
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375500 to: 3375580
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822718 to: 1822795
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579577 to: 579657
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2613944 to: 2614021
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3051957 to: 3052034
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4175 to: 4252
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 4156 to: 4233
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2099877 to: 2099954
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2634171 to: 2634248
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481818
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949374
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322204 to: 322281
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339928 to: 340005
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760965 to: 761042
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889589 to: 889666
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65713
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178900
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48822
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712874 to: 712951
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688220 to: 688297
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448268
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2209282 to: 2209359
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827069 to: 827146
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091293 to: 1091370
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161656 to: 1161733
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 828970 to: 829047
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130304 to: 1130381
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 760 to: 837
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 838 to: 915
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825314 to: 825391
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130353 to: 1130430
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4599122 to: 4599199
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 954141 to: 954218
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 664236 to: 664313
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4111855 to: 4111932
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803368 to: 803445
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684696 to: 684773
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254192 to: 254269
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 886453 to: 886530
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 1107980 to: 1108057
gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906013 to: 906090
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706145 to: 706222
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267298 to: 267378
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 1033517 to: 1033594
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939501 to: 939578
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 200
gi-nr: gi|149931032 gi_def: Bacteroides vulgatus ATCC 8482, complete genome hsp_num: 1 from: 3980335 to: 3980412
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750358 to: 750435
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299992 to: 300069
gi-nr: gi|29342101 gi_def: Bacteroides thetaiotaomicron VPI-5482, complete genome hsp_num: 1 from: 1030592 to: 1030669
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 983079 to: 983156
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529878 to: 3529955
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 956573 to: 956650
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 703555 to: 703632
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1855301 to: 1855378
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 949034 to: 949111
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 942366 to: 942443
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1019853 to: 1019930
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59585 to: 59662
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393616 to: 393693
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693193
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919679 to: 2919756
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200944 to: 3201021
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2889377 to: 2889454
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830744 to: 830821
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749976
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295883
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542927 to: 2543004
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283000 to: 3283077
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267130 to: 3267207
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191233 to: 1191310
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302223 to: 302300
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899142
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417782 to: 1417859
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369758 to: 3369835
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527889 to: 527966
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491540 to: 2491617
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693060 to: 3693137
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079053 to: 3079130
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434258 to: 3434335
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427533 to: 1427610
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992232 to: 1992309
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867742
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244878 to: 244961
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1926406 to: 1926483
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535394 to: 535471
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 939542 to: 939619
gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354214 to: 1354291
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1822939 to: 1823016
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733330 to: 733404
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 1298389 to: 1298469
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1731798 to: 1731866
gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 2 to: 70
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1512852 to: 1512929
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1063688 to: 1063756
gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2817948 to: 2818016
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575206 to: 1575280
gi-nr: gi|115249003 gi_def: Clostridium difficile 630 complete genome hsp_num: 1 from: 3272861 to: 3272929
gi-nr: gi|116101968 gi_def: Pediococcus pentosaceus ATCC 25745, complete genome hsp_num: 1 from: 1256440 to: 1256508
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2410558 to: 2410626
gi-nr: gi|125496804 gi_def: Streptococcus sanguinis SK36, complete genome hsp_num: 1 from: 106507 to: 106575
gi-nr: gi|24378526 gi_def: Streptococcus mutans UA159, complete genome hsp_num: 1 from: 288856 to: 288924
gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8478 to: 8555
gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1833 to: 1910
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1146464 to: 1146532
gi-nr: gi|116100249 gi_def: Streptococcus thermophilus LMD-9, complete genome hsp_num: 1 from: 1668310 to: 1668378
gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638383 to: 1638451
gi-nr: gi|55737978 gi_def: Streptococcus thermophilus CNRZ1066, complete genome hsp_num: 1 from: 1617034 to: 1617102
gi-nr: gi|56908016 gi_def: Bacillus clausii KSM-K16 DNA, complete genome hsp_num: 1 from: 1681227 to: 1681295
gi-nr: gi|47118318 gi_def: Bacillus halodurans C-125 DNA, complete genome hsp_num: 1 from: 1321005 to: 1321073
gi-nr: gi|55736088 gi_def: Streptococcus thermophilus LMG 18311, complete genome hsp_num: 1 from: 1614722 to: 1614790
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5881327 to: 5881395
gi-nr: gi|156095826 gi_def: Plasmodium vivax queuine tRNA ribosyltransferase, putative (PVX_101010) mRNA, complete cds hsp_num: 1 from: 1246 to: 1311
gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199453 to: 1199524
gi-nr: gi|156720466 gi_def: Staphylococcus aureus subsp. aureus Mu3 DNA, complete genome hsp_num: 1 from: 1752219 to: 1752272
gi-nr: gi|150373012 gi_def: Staphylococcus aureus subsp. aureus str. Newman genomic DNA, complete genome hsp_num: 1 from: 1709717 to: 1709770
gi-nr: gi|149944932 gi_def: Staphylococcus aureus subsp. aureus JH1, complete genome hsp_num: 1 from: 1799061 to: 1799114
gi-nr: gi|147739516 gi_def: Staphylococcus aureus subsp. aureus JH9, complete genome hsp_num: 1 from: 1799187 to: 1799240
gi-nr: gi|47208328 gi_def: Staphylococcus aureus subsp. aureus Mu50 DNA, complete genome hsp_num: 1 from: 1750819 to: 1750872
gi-nr: gi|68445725 gi_def: Staphylococcus haemolyticus JCSC1435 DNA, complete genome hsp_num: 1 from: 1313764 to: 1313817
gi-nr: gi|57284222 gi_def: Staphylococcus aureus subsp. aureus COL, complete genome hsp_num: 1 from: 1726878 to: 1726931
gi-nr: gi|87201381 gi_def: Staphylococcus aureus subsp. aureus NCTC 8325, complete genome hsp_num: 1 from: 1652918 to: 1652971
gi-nr: gi|87125858 gi_def: Staphylococcus aureus subsp. aureus USA300_FPR3757, complete genome hsp_num: 1 from: 1749715 to: 1749768
gi-nr: gi|72493824 gi_def: Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 DNA, complete genome hsp_num: 1 from: 1165599 to: 1165652
gi-nr: gi|49243355 gi_def: Staphylococcus aureus strain MSSA476, complete genome hsp_num: 1 from: 1699534 to: 1699587
gi-nr: gi|47118312 gi_def: Staphylococcus aureus subsp. aureus MW2 DNA, complete genome, strain:MW2 hsp_num: 1 from: 1719882 to: 1719935
gi-nr: gi|47118324 gi_def: Staphylococcus aureus subsp. aureus N315 genomic DNA, complete genome hsp_num: 1 from: 1674406 to: 1674459
gi-nr: gi|57636010 gi_def: Staphylococcus epidermidis RP62A, complete genome hsp_num: 1 from: 1242323 to: 1242376
gi-nr: gi|27316888 gi_def: Staphylococcus epidermidis ATCC 12228, complete genome hsp_num: 1 from: 1354398 to: 1354451
gi-nr: gi|49240382 gi_def: Staphylococcus aureus subsp. aureus strain MRSA252, complete genome hsp_num: 1 from: 1784865 to: 1784918
gi-nr: gi|82655308 gi_def: Staphylococcus aureus RF122 complete genome hsp_num: 1 from: 1628943 to: 1628996
gi-nr: gi|33632062 gi_def: Synechococcus sp. WH8102 complete genome; segment 1/7 hsp_num: 2 from: 107654 to: 107683
gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1296

Coding-DNA
gtggaaggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcacgtaacggtcacctatttgtTgacgggtggtgtgatcaagatccg
Protein-Sequence
VEGVRRGIDMFDCVMPTRNARNGHLFVDGWCDQDP
Hit-Information Section
gi-nr: gi|109703864 gi_def: Synthetic construct Vibrio cholerae clone FLH175614.01F tgt gene, complete sequence hsp_num: 4 from: 843 to: 878
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206445 to: 2206531
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056375 to: 1056461
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616050 to: 616136
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128676 to: 128762
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58556 to: 58636
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 971 to: 1051
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 972 to: 1052
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 757 to: 837
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6343 to: 6423
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202782 to: 202862
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 10951 to: 11031
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1306968 to: 1307051
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 985566 to: 985649
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3879335 to: 3879418
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1246735 to: 1246818
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4279674 to: 4279757
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1054163 to: 1054246
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 970900 to: 970983
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2945 to: 3028
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3660 to: 3743
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 3661 to: 3744
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 9823 to: 9906
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 3053 to: 3136
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5219816 to: 5219899
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5726386 to: 5726469
gi-nr: gi|13325077 gi_def: Pseudomonas syringae pv. tomato strain DC3000 Hrp pathogenicity island, complete sequence hsp_num: 1 from: 60 to: 143
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1553808 to: 1553891
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139420 to: 139500
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3280967 to: 3281050
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108331 to: 2108426
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1512598 to: 1512681
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1143593 to: 1143676
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1387183 to: 1387266
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168672 to: 1168752
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555553 to: 2555633
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459768 to: 459848
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490685 to: 490765
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 335013 to: 335093
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848445 to: 2848525
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513784 to: 3513864
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399628 to: 399708
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156836 to: 1156916
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728427 to: 728507
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352337 to: 352417
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976300 to: 976380
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199857 to: 3199937
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831885 to: 831965
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3439043 to: 3439123
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 442865 to: 442945
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552902 to: 3552982
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505993 to: 1506073
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802543 to: 802623
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390490 to: 390570
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494383 to: 494463
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985292 to: 2985372
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1049928 to: 1050008
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122788 to: 1122868
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441276 to: 441356
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356391 to: 356471
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554260 to: 1554340
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864203 to: 1864298
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3862 to: 3942
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108636 to: 1108716
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426117 to: 426197
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426117 to: 426197
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501084 to: 501164
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355526 to: 355606
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122500 to: 1122580
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490522 to: 490602
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411390 to: 2411470
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527238 to: 2527318
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506069 to: 506149
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117064 to: 1117144
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271900 to: 271980
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490524 to: 490604
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316936 to: 317016
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 315864 to: 315944
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 411987 to: 412067
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627061 to: 627141
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478453 to: 1478533
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273676 to: 1273756
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2697017 to: 2697094
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665053 to: 1665130
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900303 to: 1900380
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681709 to: 1681786
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610281 to: 1610358
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3242008 to: 3242085
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3496027 to: 3496104
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364205 to: 3364282
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2991998 to: 2992075
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883627 to: 2883704
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804900 to: 2804977
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730867 to: 2730944
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276209 to: 3276286
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730754 to: 1730831
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651633 to: 2651710
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246699 to: 3246776
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634559 to: 1634636
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 139910 to: 139990
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335472 to: 335552
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2356524 to: 2356604
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551047 to: 551127
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696561 to: 2696641
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393670 to: 2393756
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163028 to: 3163105
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3375500 to: 3375580
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822718 to: 1822795
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 579577 to: 579657
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2613944 to: 2614021
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3051957 to: 3052034
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 4175 to: 4252
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 4156 to: 4233
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2099877 to: 2099954
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2634171 to: 2634248
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481741 to: 481818
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949297 to: 3949374
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322204 to: 322281
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 339928 to: 340005
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760965 to: 761042
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889589 to: 889666
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65636 to: 65713
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178823 to: 178900
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48745 to: 48822
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712874 to: 712951
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688220 to: 688297
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448191 to: 1448268
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2209282 to: 2209359
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827069 to: 827146
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091293 to: 1091370
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161656 to: 1161733
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 828970 to: 829047
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130304 to: 1130381
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 760 to: 837
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 838 to: 915
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825314 to: 825391
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130353 to: 1130430
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4599122 to: 4599199
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 954141 to: 954218
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 664236 to: 664313
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4111855 to: 4111932
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803368 to: 803445
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684696 to: 684773
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254192 to: 254269
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 886453 to: 886530
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 1107980 to: 1108057
gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906013 to: 906090
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706145 to: 706222
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267298 to: 267378
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 1033517 to: 1033594
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 939501 to: 939578
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 123 to: 200
gi-nr: gi|149931032 gi_def: Bacteroides vulgatus ATCC 8482, complete genome hsp_num: 1 from: 3980335 to: 3980412
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750358 to: 750435
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299992 to: 300069
gi-nr: gi|29342101 gi_def: Bacteroides thetaiotaomicron VPI-5482, complete genome hsp_num: 1 from: 1030592 to: 1030669
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 983079 to: 983156
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529878 to: 3529955
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 956573 to: 956650
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 703555 to: 703632
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1855301 to: 1855378
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 949034 to: 949111
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 942366 to: 942443
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1019853 to: 1019930
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59585 to: 59662
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393616 to: 393693
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693116 to: 693193
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919679 to: 2919756
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200944 to: 3201021
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2889377 to: 2889454
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830744 to: 830821
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749899 to: 749976
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295806 to: 295883
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542927 to: 2543004
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283000 to: 3283077
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267130 to: 3267207
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191233 to: 1191310
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302223 to: 302300
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899065 to: 899142
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417782 to: 1417859
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369758 to: 3369835
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527889 to: 527966
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491540 to: 2491617
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693060 to: 3693137
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079053 to: 3079130
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434258 to: 3434335
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427533 to: 1427610
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992232 to: 1992309
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867742
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 244878 to: 244961
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1926406 to: 1926483
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535394 to: 535471
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 939542 to: 939619
gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354214 to: 1354291
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1822939 to: 1823016
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733330 to: 733404
gi-nr: gi|51854827 gi_def: Symbiobacterium thermophilum IAM 14863 DNA, complete genome hsp_num: 1 from: 1298389 to: 1298469
gi-nr: gi|83571788 gi_def: Moorella thermoacetica ATCC 39073, complete genome hsp_num: 1 from: 1731798 to: 1731866
gi-nr: gi|156774259 gi_def: Uncultured bacterium clone HA0AAA18ZA05FM1 genomic sequence hsp_num: 1 from: 2 to: 70
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1512852 to: 1512929
gi-nr: gi|146272432 gi_def: Pelotomaculum thermopropionicum SI genomic DNA, complete genome hsp_num: 1 from: 1063688 to: 1063756
gi-nr: gi|89332194 gi_def: Desulfitobacterium hafniense Y51 genomic DNA, complete genome hsp_num: 1 from: 2817948 to: 2818016
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575206 to: 1575280
gi-nr: gi|115249003 gi_def: Clostridium difficile 630 complete genome hsp_num: 1 from: 3272861 to: 3272929
gi-nr: gi|116101968 gi_def: Pediococcus pentosaceus ATCC 25745, complete genome hsp_num: 1 from: 1256440 to: 1256508
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2410558 to: 2410626
gi-nr: gi|125496804 gi_def: Streptococcus sanguinis SK36, complete genome hsp_num: 1 from: 106507 to: 106575
gi-nr: gi|24378526 gi_def: Streptococcus mutans UA159, complete genome hsp_num: 1 from: 288856 to: 288924
gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8478 to: 8555
gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1833 to: 1910
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1146464 to: 1146532
gi-nr: gi|116100249 gi_def: Streptococcus thermophilus LMD-9, complete genome hsp_num: 1 from: 1668310 to: 1668378
gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638383 to: 1638451
gi-nr: gi|55737978 gi_def: Streptococcus thermophilus CNRZ1066, complete genome hsp_num: 1 from: 1617034 to: 1617102
gi-nr: gi|56908016 gi_def: Bacillus clausii KSM-K16 DNA, complete genome hsp_num: 1 from: 1681227 to: 1681295
gi-nr: gi|47118318 gi_def: Bacillus halodurans C-125 DNA, complete genome hsp_num: 1 from: 1321005 to: 1321073
gi-nr: gi|55736088 gi_def: Streptococcus thermophilus LMG 18311, complete genome hsp_num: 1 from: 1614722 to: 1614790
gi-nr: gi|108460647 gi_def: Myxococcus xanthus DK 1622, complete genome hsp_num: 1 from: 5881327 to: 5881395
gi-nr: gi|156095826 gi_def: Plasmodium vivax queuine tRNA ribosyltransferase, putative (PVX_101010) mRNA, complete cds hsp_num: 1 from: 1246 to: 1311
gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199453 to: 1199524
gi-nr: gi|156720466 gi_def: Staphylococcus aureus subsp. aureus Mu3 DNA, complete genome hsp_num: 1 from: 1752219 to: 1752272
gi-nr: gi|150373012 gi_def: Staphylococcus aureus subsp. aureus str. Newman genomic DNA, complete genome hsp_num: 1 from: 1709717 to: 1709770
gi-nr: gi|149944932 gi_def: Staphylococcus aureus subsp. aureus JH1, complete genome hsp_num: 1 from: 1799061 to: 1799114
gi-nr: gi|147739516 gi_def: Staphylococcus aureus subsp. aureus JH9, complete genome hsp_num: 1 from: 1799187 to: 1799240
gi-nr: gi|47208328 gi_def: Staphylococcus aureus subsp. aureus Mu50 DNA, complete genome hsp_num: 1 from: 1750819 to: 1750872
gi-nr: gi|68445725 gi_def: Staphylococcus haemolyticus JCSC1435 DNA, complete genome hsp_num: 1 from: 1313764 to: 1313817
gi-nr: gi|57284222 gi_def: Staphylococcus aureus subsp. aureus COL, complete genome hsp_num: 1 from: 1726878 to: 1726931
gi-nr: gi|87201381 gi_def: Staphylococcus aureus subsp. aureus NCTC 8325, complete genome hsp_num: 1 from: 1652918 to: 1652971
gi-nr: gi|87125858 gi_def: Staphylococcus aureus subsp. aureus USA300_FPR3757, complete genome hsp_num: 1 from: 1749715 to: 1749768
gi-nr: gi|72493824 gi_def: Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 DNA, complete genome hsp_num: 1 from: 1165599 to: 1165652
gi-nr: gi|49243355 gi_def: Staphylococcus aureus strain MSSA476, complete genome hsp_num: 1 from: 1699534 to: 1699587
gi-nr: gi|47118312 gi_def: Staphylococcus aureus subsp. aureus MW2 DNA, complete genome, strain:MW2 hsp_num: 1 from: 1719882 to: 1719935
gi-nr: gi|47118324 gi_def: Staphylococcus aureus subsp. aureus N315 genomic DNA, complete genome hsp_num: 1 from: 1674406 to: 1674459
gi-nr: gi|57636010 gi_def: Staphylococcus epidermidis RP62A, complete genome hsp_num: 1 from: 1242323 to: 1242376
gi-nr: gi|27316888 gi_def: Staphylococcus epidermidis ATCC 12228, complete genome hsp_num: 1 from: 1354398 to: 1354451
gi-nr: gi|49240382 gi_def: Staphylococcus aureus subsp. aureus strain MRSA252, complete genome hsp_num: 1 from: 1784865 to: 1784918
gi-nr: gi|82655308 gi_def: Staphylococcus aureus RF122 complete genome hsp_num: 1 from: 1628943 to: 1628996
gi-nr: gi|33632062 gi_def: Synechococcus sp. WH8102 complete genome; segment 1/7 hsp_num: 2 from: 107654 to: 107683
gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1296


Query-DNA-Entry-Section

Query-DNA-Def dare_103|beg|240|length|122|forward|gi
Query_DNA-Sequence
atccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccac

Coding-DNA-Entry-Section

Coding-DNA
tccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgta
Protein-Sequence
IHNPALLPTLDWKCIRKAIDEDRFDQFCSRVLRAS*P
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616326 to: 616364
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 616364 to: 616402
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393427 to: 2393465
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156602 to: 1156640

Coding-DNA
tccataaTcctgcgttactaccaacgcttgatTggaaaTgcattcgtaaagcgattgatgaagaccgttttgaccaaTtttgtagccgagttctacgcgcgtcgta
Protein-Sequence
IHNPALLPTLDWKCIRKAIDEDRFDQFCSRVLRAS*P
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616326 to: 616364
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 616364 to: 616402
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393427 to: 2393465
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156602 to: 1156640


Query-DNA-Entry-Section

Query-DNA-Def dare_104|beg|1257|length|108|forward|gi
Query_DNA-Sequence
atgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccattatcggatgcggTt

Coding-DNA-Entry-Section

Coding-DNA
tgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccatta
Protein-Sequence
MPRWKNWSANNEEAFRSDLRDEKIRYRAIRPL
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617388 to: 617447
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057728 to: 1057787
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439716 to: 439778
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754990 to: 755052
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205170 to: 2205226

Coding-DNA
tgccgcgatggaaaaattggtcagccaacaaTgaagaagctttccgcagtgatctgcgtgacgagaaaattcgttaccgcgcgatccgtccatta
Protein-Sequence
MPRWKNWSANNEEAFRSDLRDEKIRYRAIRPL
Hit-Information Section
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617388 to: 617447
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057728 to: 1057787
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439716 to: 439778
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754990 to: 755052
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205170 to: 2205226


Query-DNA-Entry-Section

Query-DNA-Def dare_106|beg|2123|length|112|forward|gi
Query_DNA-Sequence
ggtgctttgattgcTgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatTggtggc

Coding-DNA-Entry-Section

Coding-DNA
aatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatT
Protein-Sequence
MLPISIVEERTIGPSMGQQNIDMGIQACIWGI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058574 to: 1058669
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438837 to: 438932
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755836 to: 755931
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204285 to: 2204380
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618234 to: 618329
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130726 to: 130821
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 3 from: 44 to: 67

Coding-DNA
aatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggtatT
Protein-Sequence
MLPISIVEERTIGPSMGQQNIDMGIQACIWGI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058574 to: 1058669
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438837 to: 438932
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755836 to: 755931
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204285 to: 2204380
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618234 to: 618329
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130726 to: 130821
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 3 from: 44 to: 67


Query-DNA-Entry-Section

Query-DNA-Def dare_108|beg|1406|length|111|forward|gi
Query_DNA-Sequence
ctgcttctggagtcgaaacaccgtgatatgacctttacgTacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTggaaattcgca

Coding-DNA-Entry-Section

Coding-DNA
TacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTgg
Protein-Sequence
RTSESDGRFVLVAKFTEARLHG
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 569 to: 607
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130042 to: 130095

Coding-DNA
TacttcagaatccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaTgg
Protein-Sequence
RTSESDGRFVLVAKFTEARLHG
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 569 to: 607
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130042 to: 130095


Query-DNA-Entry-Section

Query-DNA-Def dare_109|beg|683|length|110|forward|gi
Query_DNA-Sequence
ctagtgggtgtatcactaaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctacc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_110|beg|1492|length|128|forward|gi
Query_DNA-Sequence
agctcgcttacaggaaattcgcaactTacgccgttgagcTagaaatcactattttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacaacgtatcgtgg

Coding-DNA-Entry-Section

Coding-DNA
ttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgaca
Protein-Sequence
FCRNRVNELGVAEPLVQRQGAT
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057989 to: 1058048
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439458 to: 439517
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755251 to: 755310
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617649 to: 617708
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204906 to: 2204965
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987087 to: 987143
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877838 to: 3877894
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279475 to: 3279531
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267775 to: 1267831
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055684 to: 1055740
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1436 to: 1492
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8314 to: 8370
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1544 to: 1600
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514133 to: 1514189
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724882 to: 5724938
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130141 to: 130197
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972421 to: 972477
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388718 to: 1388774
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555342 to: 1555398
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218317 to: 5218373
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494583 to: 3494639
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847014 to: 2847070
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362773 to: 3362829
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308489 to: 1308545
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401083 to: 401139
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990462 to: 2990518
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882194 to: 2882250
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729412 to: 2729468
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274777 to: 3274833
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732208 to: 1732264
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650197 to: 2650253
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666506 to: 1666562
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248256 to: 1248312
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245268 to: 3245324
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683162 to: 1683218
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611734 to: 1611790
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278180 to: 4278236
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636014 to: 1636070
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110091 to: 1110147
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275237 to: 1275293
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57061 to: 57117
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803427 to: 2803483
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695481 to: 2695534
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901796 to: 1901852
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145409 to: 1145462
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597557 to: 4597610
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170134 to: 1170190
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554121 to: 2554177
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461224 to: 461280
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492141 to: 492197
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512263 to: 3512319
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977755 to: 977811
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198336 to: 3198392
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437512 to: 3437568
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444321 to: 444377
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551381 to: 3551437
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804088 to: 804144
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391946 to: 392002
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495839 to: 495895
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 703 to: 759
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983771 to: 2983827
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051473 to: 1051529
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124333 to: 1124389
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164601 to: 3164654
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442732 to: 442788
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357847 to: 357903
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427573 to: 427629
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427573 to: 427629
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12407 to: 12463
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502540 to: 502596
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1792 to: 1848
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356982 to: 357038
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124045 to: 1124101
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204238 to: 204294
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491978 to: 492034
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409958 to: 2410014
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240576 to: 3240632
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525806 to: 2525862
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507525 to: 507581
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491980 to: 492036
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7799 to: 7855
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315504 to: 315560
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317320 to: 317376
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413443 to: 413499
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285135 to: 2285191
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233732 to: 233785
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172594 to: 2172650
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232457 to: 232510
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40490 to: 40543
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853437 to: 1853493
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419960 to: 1420016
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44986 to: 45042
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940387 to: 940440
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59265 to: 59318
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217944 to: 1217997
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301584 to: 301634
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085152 to: 1085205
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714398 to: 714451
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240623 to: 1240679
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12250 to: 12303
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6718 to: 6771
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514511 to: 1514567
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371597 to: 3371650
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446560 to: 1446613
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080843 to: 3080896
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765928 to: 2765984
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621798 to: 1621857
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301214 to: 301267
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968965 to: 969018
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887961 to: 888014
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241275 to: 2241334
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531376 to: 3531429
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218734 to: 2218793
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245241 to: 2245300
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832334 to: 832387
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63997 to: 64050
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177182 to: 177235
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46061 to: 46114
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695110 to: 2695163
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395217 to: 395267
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504466 to: 1504522
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202777 to: 3202830
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526149 to: 526202
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377059 to: 3377115
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482593 to: 4482643
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793822 to: 793875
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 580052 to: 580105
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261638 to: 4261688
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140982 to: 4141032
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169720 to: 5169770
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928879 to: 4928929
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578038 to: 578094
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612210 to: 2612263
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050228 to: 3050281
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2447 to: 2500
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2286 to: 2339
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101771 to: 2101824
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632437 to: 2632490
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921336 to: 2921386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3095292 to: 3095342
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1940250 to: 1940300
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3116613 to: 3116663
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65813 to: 65863
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2541041 to: 2541091
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3284953 to: 3285003
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3268964 to: 3269014
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1189347 to: 1189397
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 300337 to: 300387
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2489654 to: 2489704
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3695018 to: 3695068
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3436216 to: 3436266
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1425818 to: 1425868
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463654 to: 1463710
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552688 to: 552738
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257754 to: 3257801
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2000685 to: 2000732
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3014553 to: 3014600
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 897289 to: 897336
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332683 to: 332739
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354691 to: 354747
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073458
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1923435 to: 1923482
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5244189 to: 5244236

Coding-DNA
ttgTcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgaca
Protein-Sequence
FCRNRVNELGVAEPLVQRQGAT
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057989 to: 1058048
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439458 to: 439517
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755251 to: 755310
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617649 to: 617708
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204906 to: 2204965
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987087 to: 987143
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877838 to: 3877894
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279475 to: 3279531
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267775 to: 1267831
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055684 to: 1055740
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1436 to: 1492
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2152 to: 2208
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8314 to: 8370
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1544 to: 1600
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514133 to: 1514189
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724882 to: 5724938
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130141 to: 130197
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972421 to: 972477
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388718 to: 1388774
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555342 to: 1555398
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218317 to: 5218373
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494583 to: 3494639
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847014 to: 2847070
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362773 to: 3362829
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308489 to: 1308545
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401083 to: 401139
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990462 to: 2990518
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882194 to: 2882250
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729412 to: 2729468
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274777 to: 3274833
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732208 to: 1732264
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650197 to: 2650253
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666506 to: 1666562
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248256 to: 1248312
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245268 to: 3245324
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683162 to: 1683218
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611734 to: 1611790
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278180 to: 4278236
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636014 to: 1636070
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110091 to: 1110147
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275237 to: 1275293
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57061 to: 57117
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803427 to: 2803483
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695481 to: 2695534
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901796 to: 1901852
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145409 to: 1145462
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597557 to: 4597610
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170134 to: 1170190
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554121 to: 2554177
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461224 to: 461280
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492141 to: 492197
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512263 to: 3512319
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977755 to: 977811
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198336 to: 3198392
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437512 to: 3437568
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444321 to: 444377
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551381 to: 3551437
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804088 to: 804144
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391946 to: 392002
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495839 to: 495895
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 703 to: 759
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983771 to: 2983827
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051473 to: 1051529
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124333 to: 1124389
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3164601 to: 3164654
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442732 to: 442788
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357847 to: 357903
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427573 to: 427629
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427573 to: 427629
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12407 to: 12463
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502540 to: 502596
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1792 to: 1848
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356982 to: 357038
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124045 to: 1124101
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204238 to: 204294
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491978 to: 492034
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409958 to: 2410014
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240576 to: 3240632
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525806 to: 2525862
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507525 to: 507581
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 703 to: 759
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491980 to: 492036
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7799 to: 7855
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315504 to: 315560
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317320 to: 317376
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413443 to: 413499
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285135 to: 2285191
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233732 to: 233785
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172594 to: 2172650
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232457 to: 232510
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40490 to: 40543
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853437 to: 1853493
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419960 to: 1420016
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44986 to: 45042
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940387 to: 940440
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59265 to: 59318
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217944 to: 1217997
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301584 to: 301634
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085152 to: 1085205
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714398 to: 714451
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240623 to: 1240679
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12250 to: 12303
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6718 to: 6771
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514511 to: 1514567
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371597 to: 3371650
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446560 to: 1446613
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080843 to: 3080896
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765928 to: 2765984
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621798 to: 1621857
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301214 to: 301267
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968965 to: 969018
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887961 to: 888014
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241275 to: 2241334
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531376 to: 3531429
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218734 to: 2218793
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245241 to: 2245300
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832334 to: 832387
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63997 to: 64050
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177182 to: 177235
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46061 to: 46114
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695110 to: 2695163
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395217 to: 395267
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504466 to: 1504522
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202777 to: 3202830
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526149 to: 526202
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377059 to: 3377115
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482593 to: 4482643
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793822 to: 793875
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 580052 to: 580105
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261638 to: 4261688
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140982 to: 4141032
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169720 to: 5169770
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928879 to: 4928929
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578038 to: 578094
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2612210 to: 2612263
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3050228 to: 3050281
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 2447 to: 2500
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 2286 to: 2339
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2101771 to: 2101824
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2632437 to: 2632490
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921336 to: 2921386
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3095292 to: 3095342
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1940250 to: 1940300
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3116613 to: 3116663
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65813 to: 65863
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2541041 to: 2541091
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3284953 to: 3285003
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3268964 to: 3269014
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1189347 to: 1189397
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 300337 to: 300387
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2489654 to: 2489704
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3695018 to: 3695068
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3436216 to: 3436266
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1425818 to: 1425868
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463654 to: 1463710
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552688 to: 552738
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3257754 to: 3257801
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2000685 to: 2000732
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3014553 to: 3014600
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 897289 to: 897336
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332683 to: 332739
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354691 to: 354747
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073458
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1923435 to: 1923482
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5244189 to: 5244236


Query-DNA-Entry-Section

Query-DNA-Def dare_111|beg|1111|length|115|forward|gi
Query_DNA-Sequence
cagTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaatgaaactcggccttgatctgcgtg

Coding-DNA-Entry-Section

Coding-DNA
agTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaa
Protein-Sequence
VEALGKDKIVALNLAPSTPYWLESIGAAPN
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 796115 to: 796198
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 277 to: 360
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 286825 to: 286908
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439869 to: 439952
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754816 to: 754899
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057554 to: 1057637
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617214 to: 617297
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205317 to: 2205400
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803832 to: 2803909
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267343 to: 1267423
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129709 to: 129792
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901370 to: 1901447

Coding-DNA
agTtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggctagagtcaattggtgctgcaccTaa
Protein-Sequence
VEALGKDKIVALNLAPSTPYWLESIGAAPN
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 1 from: 796115 to: 796198
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 277 to: 360
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 286825 to: 286908
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439869 to: 439952
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754816 to: 754899
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057554 to: 1057637
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617214 to: 617297
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205317 to: 2205400
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803832 to: 2803909
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267343 to: 1267423
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129709 to: 129792
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901370 to: 1901447


Query-DNA-Entry-Section

Query-DNA-Def dare_112|beg|1551|length|121|forward|gi
Query_DNA-Sequence
accgggtgaacgaacttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcga

Coding-DNA-Entry-Section

Coding-DNA
cttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcg
Protein-Sequence
NLGVAEPLVQRQGATRIVVELPGVQDTARAKEILGA
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796565 to: 796669
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 727 to: 831
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287275 to: 287379
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058007 to: 1058111
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439395 to: 439499
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755373
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617771
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204947
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130263
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846948 to: 2847052
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401101 to: 401205
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110213
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275359
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56995 to: 57099
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170152 to: 1170256
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554055 to: 2554159
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461242 to: 461346
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492159 to: 492263
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512197 to: 3512301
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362707 to: 3362811
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882128 to: 2882232
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977773 to: 977877
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198270 to: 3198374
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274711 to: 3274815
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437446 to: 3437550
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650131 to: 2650235
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666524 to: 1666628
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444339 to: 444443
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551315 to: 3551419
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245202 to: 3245306
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683180 to: 1683284
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611752 to: 1611856
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504400 to: 1504504
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804210
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392068
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495857 to: 495961
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 825
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983705 to: 2983809
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051595
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124455
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636032 to: 1636136
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442750 to: 442854
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357969
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427591 to: 427695
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427591 to: 427695
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12425 to: 12529
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502558 to: 502662
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1810 to: 1914
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357104
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124167
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204256 to: 204360
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491996 to: 492100
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409892 to: 2409996
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525740 to: 2525844
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507543 to: 507647
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491998 to: 492102
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7817 to: 7921
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315438 to: 315542
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317442
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413461 to: 413565
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732226 to: 1732330
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803361 to: 2803465
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901814 to: 1901918
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285069 to: 2285173
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494517 to: 3494621
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729346 to: 2729450
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240510 to: 3240614
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695412 to: 2695516
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267897
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463672 to: 1463776
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235569 to: 1235673
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724819 to: 5724920
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332617 to: 332721
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153867 to: 1153971
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726031 to: 726135
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354709 to: 354813
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987105 to: 987206
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877775 to: 3877876
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420082
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055803
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1373 to: 1474
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8251 to: 8352
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1481 to: 1582
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514252
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972439 to: 972540
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269504 to: 269608
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388837
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555461
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279412 to: 3279513
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628528 to: 628632
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2109 to: 2219
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336960 to: 337064
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990396 to: 2990500
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940422
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218254 to: 5218355
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308608
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248375
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278117 to: 4278218
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556648 to: 1556752
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59196 to: 59300
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714416 to: 714520
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695041 to: 2695145
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597488 to: 4597592
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164619 to: 3164723
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145427 to: 1145531
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446491 to: 1446595
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301697
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531391 to: 3531492
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172713
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853371 to: 1853475
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371612 to: 3371713
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526086 to: 526187
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080858 to: 3080959
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232475 to: 232579
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301229 to: 301330
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533806 to: 533907
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887898 to: 887999
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832349 to: 832450
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169654 to: 5169755
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482527 to: 4482628
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261572 to: 4261673
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140916 to: 4141017
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968902 to: 969003
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202792 to: 3202893
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928813 to: 4928914
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317807 to: 4317908
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63934 to: 64035
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177119 to: 177220
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45998 to: 46099
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765865 to: 2765966
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40609
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514529 to: 1514630
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377077 to: 3377178
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921351 to: 2921452
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1334061 to: 1334162
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1539441 to: 1539542
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577975 to: 578076
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126061 to: 1126162
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621738 to: 1621839
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241215 to: 2241316
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44923 to: 45024
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218674 to: 2218775
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245181 to: 2245282
gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 661706 to: 661774
gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 332251 to: 332319
gi-nr: gi|642362 gi_def: T.thermophilus nusA/infB operon DNA hsp_num: 1 from: 4529 to: 4594

Coding-DNA
cttgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcg
Protein-Sequence
NLGVAEPLVQRQGATRIVVELPGVQDTARAKEILGA
Hit-Information Section
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796565 to: 796669
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 727 to: 831
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287275 to: 287379
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058007 to: 1058111
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439395 to: 439499
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755373
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617771
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204947
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130263
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846948 to: 2847052
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401101 to: 401205
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110213
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275359
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56995 to: 57099
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170152 to: 1170256
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554055 to: 2554159
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461242 to: 461346
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492159 to: 492263
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512197 to: 3512301
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362707 to: 3362811
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882128 to: 2882232
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977773 to: 977877
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198270 to: 3198374
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274711 to: 3274815
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437446 to: 3437550
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650131 to: 2650235
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666524 to: 1666628
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444339 to: 444443
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551315 to: 3551419
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245202 to: 3245306
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683180 to: 1683284
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611752 to: 1611856
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504400 to: 1504504
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804210
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392068
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495857 to: 495961
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 825
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983705 to: 2983809
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051595
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124455
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636032 to: 1636136
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442750 to: 442854
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357969
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427591 to: 427695
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427591 to: 427695
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12425 to: 12529
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502558 to: 502662
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1810 to: 1914
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357104
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124167
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204256 to: 204360
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491996 to: 492100
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409892 to: 2409996
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525740 to: 2525844
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507543 to: 507647
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 721 to: 825
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491998 to: 492102
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7817 to: 7921
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315438 to: 315542
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317442
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413461 to: 413565
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732226 to: 1732330
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803361 to: 2803465
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901814 to: 1901918
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285069 to: 2285173
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494517 to: 3494621
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729346 to: 2729450
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240510 to: 3240614
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695412 to: 2695516
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267897
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463672 to: 1463776
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235569 to: 1235673
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724819 to: 5724920
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332617 to: 332721
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153867 to: 1153971
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726031 to: 726135
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354709 to: 354813
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987105 to: 987206
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877775 to: 3877876
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420082
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055803
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1373 to: 1474
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2089 to: 2190
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8251 to: 8352
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1481 to: 1582
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514252
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972439 to: 972540
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269504 to: 269608
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388837
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555461
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279412 to: 3279513
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628528 to: 628632
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2109 to: 2219
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 336960 to: 337064
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990396 to: 2990500
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940422
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218254 to: 5218355
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308608
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248375
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278117 to: 4278218
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556648 to: 1556752
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59196 to: 59300
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714416 to: 714520
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695041 to: 2695145
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597488 to: 4597592
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164619 to: 3164723
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145427 to: 1145531
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446491 to: 1446595
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301697
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531391 to: 3531492
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172713
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853371 to: 1853475
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371612 to: 3371713
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526086 to: 526187
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080858 to: 3080959
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232475 to: 232579
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301229 to: 301330
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533806 to: 533907
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887898 to: 887999
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 832349 to: 832450
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169654 to: 5169755
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482527 to: 4482628
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261572 to: 4261673
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140916 to: 4141017
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968902 to: 969003
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3202792 to: 3202893
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928813 to: 4928914
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317807 to: 4317908
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63934 to: 64035
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177119 to: 177220
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45998 to: 46099
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765865 to: 2765966
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40609
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514529 to: 1514630
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377077 to: 3377178
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2921351 to: 2921452
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1334061 to: 1334162
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1539441 to: 1539542
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577975 to: 578076
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126061 to: 1126162
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621738 to: 1621839
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241215 to: 2241316
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44923 to: 45024
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218674 to: 2218775
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245181 to: 2245282
gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 661706 to: 661774
gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 332251 to: 332319
gi-nr: gi|642362 gi_def: T.thermophilus nusA/infB operon DNA hsp_num: 1 from: 4529 to: 4594


Query-DNA-Entry-Section

Query-DNA-Def dare_113|beg|1511|length|106|forward|gi
Query_DNA-Sequence
cgcaactacgccgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgacaTcgtatc

Coding-DNA-Entry-Section

Coding-DNA
cgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgac
Protein-Sequence
DVAPLALEPEAQATPSSFTRLRKIVVFCSTA
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287223 to: 287285
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796513 to: 796575
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 675 to: 737
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057955 to: 1058017
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439489 to: 439551
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755217 to: 755279
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617615 to: 617677
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130107 to: 130178
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204937 to: 2204999
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1170106 to: 1170162
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512291 to: 3512347
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198364 to: 3198420
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551409 to: 3551465
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 804060 to: 804116
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 675 to: 731
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2983799 to: 2983855
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051445 to: 1051501
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1124305 to: 1124361
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1124017 to: 1124073
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803455 to: 2803511
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901768 to: 1901824
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479930 to: 1479989
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 401055 to: 401111
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301550 to: 301606
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650225 to: 2650281
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332705 to: 332767
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726119 to: 726181
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269592 to: 269654
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395183 to: 395236
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853465 to: 1853521
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 2314 to: 2367
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 2 from: 2101743 to: 2101796

Coding-DNA
cgttgagcagaacacTactattttgcgtaaccgggtgaacgaactgggtgtggctTgagcctctggttcTaacgccaaTggtgcgac
Protein-Sequence
DVAPLALEPEAQATPSSFTRLRKIVVFCSTA
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287223 to: 287285
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 6 from: 796513 to: 796575
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 675 to: 737
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057955 to: 1058017
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439489 to: 439551
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755217 to: 755279
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617615 to: 617677
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130107 to: 130178
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204937 to: 2204999
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1170106 to: 1170162
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512291 to: 3512347
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198364 to: 3198420
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551409 to: 3551465
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 804060 to: 804116
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 675 to: 731
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2983799 to: 2983855
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051445 to: 1051501
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1124305 to: 1124361
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1124017 to: 1124073
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803455 to: 2803511
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901768 to: 1901824
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479930 to: 1479989
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 401055 to: 401111
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301550 to: 301606
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650225 to: 2650281
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332705 to: 332767
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726119 to: 726181
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269592 to: 269654
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395183 to: 395236
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853465 to: 1853521
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 2314 to: 2367
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 2 from: 2101743 to: 2101796


Query-DNA-Entry-Section

Query-DNA-Def dare_115|beg|1360|length|110|forward|gi
Query_DNA-Sequence
ggttgaagtgaccctgcgtgatgccgagcagcttgcgcaaactaagctgcttctggagTtcgaaacaTccgtgatatgacctttacgacttcagaatccgatggccgttt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_119|beg|1626|length|124|forward|gi
Query_DNA-Sequence
cgggtgtacaagatacagcgTcTgtgctaaagaaatcttaggcgcgaccgcTaacccttgaatttTcgtgaagtggacgTataaagcgaccttgccgctgcggcagcaggacgtgcgcctgctg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_120|beg|1816|length|111|forward|gi
Query_DNA-Sequence
aagcatttaccgatgcaagctcaagcgccgacgaatatggtcgcccacaggTtgaacatttcgctcgTatagcgaaggcgcaacaaatgtcagcgttctcgaaaaagaaca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_121|beg|794|length|124|forward|gi
Query_DNA-Sequence
aaaggtacgcTtgaaatctctttaaaacagccataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgcacttcca

Coding-DNA-Entry-Section

Coding-DNA
ataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgca
Protein-Sequence
HRILAVLNRYPLWKYLMVMLTIAVAALYA
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440151 to: 440273
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754495 to: 754617
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555925 to: 1556005

Coding-DNA
ataggatcctcgctgtgctaaaccgttatccgttatggaagtatctgatggtgatgttaaccatcgccgttgcagccttgtatgca
Protein-Sequence
HRILAVLNRYPLWKYLMVMLTIAVAALYA
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440151 to: 440273
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754495 to: 754617
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1555925 to: 1556005


Query-DNA-Entry-Section

Query-DNA-Def dare_124|beg|1159|length|123|forward|gi
Query_DNA-Sequence
ttcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtcag

Coding-DNA-Entry-Section

Coding-DNA
tcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtc
Protein-Sequence
FNAILAKSIGAAPMKLGLDLRGGVHFLMEVGYGCRDGKIGQ
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754879 to: 754950
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439818 to: 439889
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129772 to: 129843
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205266 to: 2205334
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285483 to: 2285554
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4144619 to: 4144687
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729837
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597911 to: 4597979
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803781 to: 2803852
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 3 from: 1803433 to: 1803498
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1182999 to: 1183070
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109734 to: 1109799
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 1144386 to: 1144454
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479601 to: 1479672
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267403 to: 1267474
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650551 to: 2650622
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 3001931 to: 3001996
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169777 to: 1169842
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057617 to: 1057688
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617277 to: 617348
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394842 to: 394913
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376690 to: 3376761
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901427 to: 1901498
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 2890258 to: 2890323
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635645 to: 1635716
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578392 to: 578463
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279829 to: 3279900
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40130 to: 40195
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6361 to: 6432
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695535
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766350
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534294
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 343 to: 411
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11893 to: 11964
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628150 to: 628215
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126481 to: 1126552
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154281 to: 1154349
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2523 to: 2591
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1823587 to: 1823652
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556270 to: 1556338
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463294 to: 1463362
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622152 to: 1622223
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241629 to: 2241700
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219088 to: 2219159
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245595 to: 2245666
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504814 to: 1504882
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940797
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145049 to: 1145117
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 333031 to: 333093
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726445 to: 726507
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354337 to: 354399
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235194 to: 1235259
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269918 to: 269980
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59675
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371249 to: 3371308
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080495 to: 3080554
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793468 to: 793533
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 579698 to: 579763
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637094 to: 637159
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190327 to: 190392
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888315 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64351 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177536 to: 177589
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46415 to: 46468
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073815
gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1335660 to: 1335725
gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 798703 to: 798768
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 4 from: 192541 to: 192573
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12619

Coding-DNA
tcaacgccatattggctaagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttcctgatggaagtgggatatggatgccgcgatggaaaaattggtc
Protein-Sequence
FNAILAKSIGAAPMKLGLDLRGGVHFLMEVGYGCRDGKIGQ
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754879 to: 754950
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439818 to: 439889
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129772 to: 129843
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205266 to: 2205334
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285483 to: 2285554
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 5 from: 4144619 to: 4144687
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729837
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597911 to: 4597979
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803781 to: 2803852
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 3 from: 1803433 to: 1803498
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 4 from: 1182999 to: 1183070
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109734 to: 1109799
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 1144386 to: 1144454
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1479601 to: 1479672
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267403 to: 1267474
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650551 to: 2650622
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 3001931 to: 3001996
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169777 to: 1169842
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057617 to: 1057688
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617277 to: 617348
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394842 to: 394913
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376690 to: 3376761
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901427 to: 1901498
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 3 from: 2890258 to: 2890323
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635645 to: 1635716
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 578392 to: 578463
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279829 to: 3279900
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40130 to: 40195
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6361 to: 6432
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695535
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766350
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534294
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 343 to: 411
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11893 to: 11964
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628150 to: 628215
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126481 to: 1126552
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1154281 to: 1154349
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2523 to: 2591
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1823587 to: 1823652
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556270 to: 1556338
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463294 to: 1463362
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622152 to: 1622223
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241629 to: 2241700
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219088 to: 2219159
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245595 to: 2245666
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504814 to: 1504882
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940797
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145049 to: 1145117
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 333031 to: 333093
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726445 to: 726507
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354337 to: 354399
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235194 to: 1235259
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269918 to: 269980
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59675
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371249 to: 3371308
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080495 to: 3080554
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793468 to: 793533
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 579698 to: 579763
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 637094 to: 637159
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 190327 to: 190392
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 888315 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 64351 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177536 to: 177589
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 46415 to: 46468
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073815
gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1335660 to: 1335725
gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 798703 to: 798768
gi-nr: gi|33577672 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 15/16 hsp_num: 4 from: 192541 to: 192573
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 12569 to: 12619


Query-DNA-Entry-Section

Query-DNA-Def dare_126|beg|1092|length|113|forward|gi
Query_DNA-Sequence
tcagcgccccgagaTtatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaaTcgccatattggctagagTtcaattggtgctgcaccaat

Coding-DNA-Entry-Section

Coding-DNA
atcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaaT
Protein-Sequence
MAIEGARFNATILSLPNASLMI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057544 to: 1057603
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439903 to: 439959
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754809 to: 754865
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617207 to: 617263


Query-DNA-Entry-Section

Query-DNA-Def dare_128|beg|2104|length|104|forward|gi
Query_DNA-Sequence
tgctctgctattgcgtgccggTtgctttgattgcgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtatt

Coding-DNA-Entry-Section

Coding-DNA
gctctgctattgcgtgccggTtgctttgattgcgccaatttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtatt
Protein-Sequence
LCYCVPVALIAPISIVEERTIGPSMGQQNIDMGI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058568 to: 1058648
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438858 to: 438938
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755830 to: 755910
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618228 to: 618308
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130720 to: 130800
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204306 to: 2204386
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802824 to: 2802904
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902375 to: 1902455
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284538 to: 2284615
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694875 to: 2694955
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728812 to: 2728892
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667082 to: 1667162
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683738 to: 1683818
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392525 to: 392605
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 358426 to: 358506
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357561 to: 357641
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492557 to: 492637
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492559 to: 492639
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 314901 to: 314981
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 414022 to: 414102
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694501 to: 2694578
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239976 to: 3240056
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824544 to: 1824624
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553288 to: 553368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63433 to: 63510
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176618 to: 176695
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45497 to: 45574
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 1 to: 42


Query-DNA-Entry-Section

Query-DNA-Def dare_129|beg|950|length|135|forward|gi
Query_DNA-Sequence
acagggcgcgtggcgcctctgtttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaagcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacgga

Coding-DNA-Entry-Section

Coding-DNA
gcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacg
Protein-Sequence
SATSPKNPLLLKMAQSLFVSMIR
Hit-Information Section

Coding-DNA
gcgcaacctctcccaaaaatccattgctcttgaaaatggctcaatccttgttcgtttcaatgatacg
Protein-Sequence
SATSPKNPLLLKMAQSLFVSMIR
Hit-Information Section


Query-DNA-Entry-Section

Query-DNA-Def dare_131|beg|675|length|113|forward|gi
Query_DNA-Sequence
ctggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaTcgaagttgtgatcaagaaggacTttcgtgactgcag

Coding-DNA-Entry-Section

Coding-DNA
tggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaT
Protein-Sequence
GGLVGRITKIAEDNAYITIELNTNN
Hit-Information Section
gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 4 from: 193 to: 267
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 286387 to: 286461
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 795677 to: 795751
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616776 to: 616850

Coding-DNA
tggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatcgagttgaacaccaacaaT
Protein-Sequence
GGLVGRITKIAEDNAYITIELNTNN
Hit-Information Section
gi-nr: gi|109703865 gi_def: Synthetic construct Vibrio cholerae clone FLH175625.01F VC0742 gene, complete sequence hsp_num: 4 from: 193 to: 267
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 286387 to: 286461
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 3 from: 795677 to: 795751
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616776 to: 616850


Query-DNA-Entry-Section

Query-DNA-Def dare_136|beg|177|length|143|forward|gi
Query_DNA-Sequence
tcgaagtcatacctgcatTcatctggatcgctgtaacgaaatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaatt

Coding-DNA-Entry-Section

Coding-DNA
aatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaa
Protein-Sequence
RNPRCTLELLSITCVTTNALMESIRKAIDEDRFDQ
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 753961 to: 754008
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 440760 to: 440807
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056639 to: 1056686
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616314 to: 616361
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 128940 to: 128984
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1554524 to: 1554568
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393430 to: 2393477
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 1024 to: 1071
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1102 to: 1149
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091059 to: 1091106
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825578 to: 825625
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829234 to: 829281
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130119 to: 1130166
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130070 to: 1130117
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827333 to: 827380
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161428 to: 1161469
gi-nr: gi|156720437 gi_def: Uncultured crenarchaeote amoA gene for ammonia monooxygenase subunit A, partial cds, clone: DGGE_AOA_6 hsp_num: 1 from: 99 to: 164

Coding-DNA
aatcctcggtgcacgcttgaatTactatccataacctgcgttactaccaacgctttgatggaaagcattcgtaaagcgattgatgaagaccgttttgaccaa
Protein-Sequence
RNPRCTLELLSITCVTTNALMESIRKAIDEDRFDQ
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 753961 to: 754008
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 440760 to: 440807
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056639 to: 1056686
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616314 to: 616361
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 128940 to: 128984
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1554524 to: 1554568
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393430 to: 2393477
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 1024 to: 1071
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1102 to: 1149
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091059 to: 1091106
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825578 to: 825625
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829234 to: 829281
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130119 to: 1130166
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130070 to: 1130117
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827333 to: 827380
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161428 to: 1161469
gi-nr: gi|156720437 gi_def: Uncultured crenarchaeote amoA gene for ammonia monooxygenase subunit A, partial cds, clone: DGGE_AOA_6 hsp_num: 1 from: 99 to: 164


Query-DNA-Entry-Section

Query-DNA-Def dare_137|beg|2435|length|131|forward|gi
Query_DNA-Sequence
gagctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtaca

Coding-DNA-Entry-Section

Coding-DNA
agctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgct
Protein-Sequence
SLLRNGKNPQQAIHQGYR*R
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1600 to: 1644
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288148 to: 288192
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204074
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618540 to: 618584
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058880 to: 1058924
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 278 to: 322
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284259 to: 2284291

Coding-DNA
attcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtac
Protein-Sequence
RIQYHCRCQHHHLNYGDHFVCRWY
Hit-Information Section
gi-nr: gi|109464452 gi_def: PREDICTED: Rattus norvegicus complement component 7 (C7), mRNA hsp_num: 2 from: 2043 to: 2069
gi-nr: gi|24580364 gi_def: Homo sapiens chromosome 16 clone CTD-3032L3, complete sequence hsp_num: 1 from: 43502 to: 43528
gi-nr: gi|57900987 gi_def: Mus musculus chromosome 7, clone RP23-449M8, complete sequence hsp_num: 1 from: 59943 to: 59975

Coding-DNA
agctTacTgcgTaaTggaaaaaatccgcagcaagcgattcatcaaggttaTcgct
Protein-Sequence
SLLRNGKNPQQAIHQGYR*R
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 2 from: 1600 to: 1644
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 2 from: 288148 to: 288192
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204074
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618540 to: 618584
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058880 to: 1058924
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 278 to: 322
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284259 to: 2284291

Coding-DNA
attcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtac
Protein-Sequence
RIQYHCRCQHHHLNYGDHFVCRWY
Hit-Information Section
gi-nr: gi|109464452 gi_def: PREDICTED: Rattus norvegicus complement component 7 (C7), mRNA hsp_num: 2 from: 2043 to: 2069
gi-nr: gi|24580364 gi_def: Homo sapiens chromosome 16 clone CTD-3032L3, complete sequence hsp_num: 1 from: 43502 to: 43528
gi-nr: gi|57900987 gi_def: Mus musculus chromosome 7, clone RP23-449M8, complete sequence hsp_num: 1 from: 59943 to: 59975


Query-DNA-Entry-Section

Query-DNA-Def dare_138|beg|1224|length|120|forward|gi
Query_DNA-Sequence
gtggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctgTcgtgTacgagaaaaattcgttaccgcgcgat

Coding-DNA-Entry-Section

Coding-DNA
tggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctg
Protein-Sequence
WCALPMEVDMDAAMEKLVSQQEEAFRSDL
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439755 to: 439826
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754942 to: 755013
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057680 to: 1057751
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617340 to: 617411
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129835 to: 129906

Coding-DNA
tggtgtgcacttccgatggaagtggatatggatgccgcgatggaaaaattggtcagccaacaagaagaagctttccgcagtgatctg
Protein-Sequence
WCALPMEVDMDAAMEKLVSQQEEAFRSDL
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439755 to: 439826
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754942 to: 755013
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057680 to: 1057751
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617340 to: 617411
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129835 to: 129906


Query-DNA-Entry-Section

Query-DNA-Def dare_141|beg|1769|length|135|forward|gi
Query_DNA-Sequence
aatTggtTcgcctgtggtgctgTaaaaagcgcgtgaTttctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgcccacaTggtgaacattttcgctcgatagcgaaggcggcaaca

Coding-DNA-Entry-Section

Coding-DNA
atTggtTcgcctgtggtgctgTaaaaagcgcgtgaTttctgggtggttcaagcattaccgatgcaagctcaagcgccgacgaatatggtcgc
Protein-Sequence
GRPYSSALELASVMLEPPRNHALFTAPQANQ
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204652 to: 2204708
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058246 to: 1058305
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130398 to: 130454
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617906 to: 617962


Query-DNA-Entry-Section

Query-DNA-Def dare_143|beg|2118|length|122|forward|gi
Query_DNA-Sequence
gtgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaatgggtcagcagaatatcgatatgggtattcaggcctgtatttggggggtatggttggcggt

Coding-DNA-Entry-Section

Coding-DNA
tgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaa
Protein-Sequence
IDGPMVRSSDDRNWRNQSTG
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 1314 to: 1385
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058594 to: 1058665
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 287862 to: 287933
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797152 to: 797223
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438841 to: 438912
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 755856 to: 755927
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204289 to: 2204360
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618254 to: 618325
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 5 from: 3 to: 41
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125504 to: 1125554

Coding-DNA
tgccggtgctttgattgcgccaatttctatcgtcTgaagagcgcaccattggtccatcaa
Protein-Sequence
IDGPMVRSSDDRNWRNQSTG
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 6 from: 1314 to: 1385
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058594 to: 1058665
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 287862 to: 287933
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797152 to: 797223
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438841 to: 438912
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 755856 to: 755927
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204289 to: 2204360
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618254 to: 618325
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 5 from: 3 to: 41
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1125504 to: 1125554


Query-DNA-Entry-Section

Query-DNA-Def dare_145|beg|2338|length|126|forward|gi
Query_DNA-Sequence
gggcgcaaccatgaccttgccgggtattgctggtatcgtTgttgacgggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaatcc

Coding-DNA-Entry-Section

Coding-DNA
ggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaa
Protein-Sequence
RVGMVWSDANVLIFERIREDATRRKK
Hit-Information Section
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553561 to: 553608
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 239 to: 277
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 4 from: 1902648 to: 1902686
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058841 to: 1058879
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756103 to: 756141
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618501 to: 618539
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438627 to: 438665
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204075 to: 2204113
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130993 to: 131031
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694629 to: 2694682
gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 2 from: 1636 to: 1674
gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 2 from: 1714 to: 1752
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2802593 to: 2802631
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3165447 to: 3165485
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 337797 to: 337835
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 2 from: 62953 to: 62991
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 1869566 to: 1869604
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1996463 to: 1996501
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1156305 to: 1156343
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1085939 to: 1085977
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 830708 to: 830746
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 834364 to: 834402
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1125000 to: 1125038
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1124951 to: 1124989
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 832463 to: 832501
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44724 to: 44762
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069482 to: 1069520
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125272 to: 1125310
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428793 to: 1428831
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724042 to: 5724080
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1309347 to: 1309385
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1249114 to: 1249152
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 2 from: 5217474 to: 5217512
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556200 to: 1556238
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4277340 to: 4277378
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 973276 to: 973314
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389576 to: 1389614
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987942 to: 987980
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1056539 to: 1056577
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 2 from: 3876998 to: 3877036
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 2169268 to: 2169306
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1503629 to: 1503667
gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 2 from: 1591 to: 1629
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244278
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 2 from: 209332 to: 209373
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 596 to: 634
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 7474 to: 7512
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 896500 to: 896538
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 2 from: 2695339 to: 2695377
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 704 to: 742
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1922646 to: 1922684
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1920622 to: 1920660
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887341 to: 2887379
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883604
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694270 to: 2694308
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636808 to: 1636855
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445717 to: 1445755
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356905 to: 356943
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153096 to: 1153134
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1557485 to: 1557523
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480813 to: 1480851
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333272 to: 1333310
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540293 to: 1540331
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 2 from: 673411 to: 673449
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824814 to: 1824852
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924362 to: 1924400
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596735 to: 4596773
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994321 to: 1994359
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268621 to: 1268659
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941628 to: 941666
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620964 to: 1621002
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244407 to: 2244445
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240441 to: 2240479
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217900 to: 2217938
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420821 to: 1420859
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841183 to: 1841221
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 72044 to: 72082
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852600 to: 1852638
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217107 to: 1217145
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084315 to: 1084353
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331846 to: 331884
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725260 to: 725298
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268733 to: 268771
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355545 to: 355583
gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 2 from: 1261 to: 1299
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072565 to: 1072603
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939544 to: 939582
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377959 to: 3377997
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 577156 to: 577194
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1338 to: 1376
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994965 to: 3995003
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278635 to: 3278673
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709778 to: 1709816
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 5243400 to: 5243438
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618779 to: 4618817
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224469 to: 4224507
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3013761 to: 3013799
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 3256965 to: 3257003
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244437 to: 3244475
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145547 to: 1145582
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 2001483 to: 2001521
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 2 from: 2056492 to: 2056533
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 1939464 to: 1939502
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65027 to: 65065
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1546 to: 1581
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3115827 to: 3115865
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534114 to: 1534152
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3094506 to: 3094544
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905662 to: 905700
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 2 from: 1017561 to: 1017599
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 2 from: 745417 to: 745455
gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190686 to: 190724
gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 2 from: 44770 to: 44808
gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 2 from: 144117 to: 144155
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745849 to: 7745887
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401997 to: 2402035
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183384 to: 183422
gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 2 from: 8465 to: 8503
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122460 to: 122498
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834634 to: 1834672
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 4 from: 3000800 to: 3000835
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131764 to: 2131802
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476987 to: 1477025
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143857 to: 143895
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 234584 to: 234622
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 2 from: 401537 to: 401572
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 233309 to: 233347
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650961 to: 1650996
gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358106 to: 1358144
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 2 from: 1208203 to: 1208238
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 2 from: 1268936 to: 1268971
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492802 to: 1492837
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692405 to: 692440
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631895 to: 631930
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156360 to: 156395
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081115 to: 1081153
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10477 to: 10515
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13862 to: 13900
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 2 from: 1610 to: 1648
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 1449 to: 1487
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629540 to: 1629575
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598146 to: 1598181
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560684 to: 1560719
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572088 to: 572123
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152867 to: 1152902
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026518 to: 1026553
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043489 to: 1043524
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029103 to: 1029138
gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4498 to: 4536
gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521326 to: 2521364
gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553776 to: 2553814
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 2 from: 734897 to: 734932
gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 2 from: 233401 to: 233436
gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438197 to: 2438235
gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224723 to: 2224761
gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107227 to: 2107265
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877871 to: 877909
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824167 to: 824205
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715250 to: 715288
gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048803 to: 1048841
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575587 to: 1575622
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415154 to: 2415192

Coding-DNA
ggtcggtatggTcTggtcTgatgccaacgtactgattttcgagcgtattcgtgaagaTgctacgcgaaggaaaaaa
Protein-Sequence
RVGMVWSDANVLIFERIREDATRRKK
Hit-Information Section
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553561 to: 553608
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 239 to: 277
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 4 from: 1902648 to: 1902686
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058841 to: 1058879
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 756103 to: 756141
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618501 to: 618539
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 438627 to: 438665
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204075 to: 2204113
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130993 to: 131031
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2694629 to: 2694682
gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 2 from: 1636 to: 1674
gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 2 from: 1714 to: 1752
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2802593 to: 2802631
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 2 from: 3165447 to: 3165485
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 337797 to: 337835
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 2 from: 62953 to: 62991
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 2 from: 1869566 to: 1869604
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 2 from: 1996463 to: 1996501
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 2 from: 1156305 to: 1156343
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1085939 to: 1085977
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 830708 to: 830746
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 834364 to: 834402
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1125000 to: 1125038
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1124951 to: 1124989
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 832463 to: 832501
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 2 from: 44724 to: 44762
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069482 to: 1069520
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125272 to: 1125310
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428793 to: 1428831
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 2 from: 5724042 to: 5724080
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1309347 to: 1309385
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1249114 to: 1249152
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 2 from: 5217474 to: 5217512
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 2 from: 1556200 to: 1556238
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 2 from: 4277340 to: 4277378
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 973276 to: 973314
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 2 from: 1389576 to: 1389614
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987942 to: 987980
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 2 from: 1056539 to: 1056577
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 2 from: 3876998 to: 3877036
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 4 from: 2169268 to: 2169306
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1503629 to: 1503667
gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 2 from: 1591 to: 1629
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244278
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 2 from: 209332 to: 209373
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 596 to: 634
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 7474 to: 7512
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 2 from: 896500 to: 896538
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 2 from: 2695339 to: 2695377
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 2 from: 1312 to: 1350
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 2 from: 704 to: 742
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 2 from: 1922646 to: 1922684
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 4 from: 1920622 to: 1920660
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887341 to: 2887379
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883604
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694270 to: 2694308
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636808 to: 1636855
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445717 to: 1445755
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356905 to: 356943
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153096 to: 1153134
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1557485 to: 1557523
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480813 to: 1480851
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333272 to: 1333310
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540293 to: 1540331
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 2 from: 673411 to: 673449
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1824814 to: 1824852
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924362 to: 1924400
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596735 to: 4596773
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994321 to: 1994359
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268621 to: 1268659
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941628 to: 941666
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620964 to: 1621002
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244407 to: 2244445
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240441 to: 2240479
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217900 to: 2217938
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420821 to: 1420859
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841183 to: 1841221
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 72044 to: 72082
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852600 to: 1852638
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1217107 to: 1217145
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1084315 to: 1084353
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331846 to: 331884
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725260 to: 725298
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268733 to: 268771
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355545 to: 355583
gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 2 from: 1261 to: 1299
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072565 to: 1072603
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939544 to: 939582
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3377959 to: 3377997
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 577156 to: 577194
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1338 to: 1376
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994965 to: 3995003
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3278635 to: 3278673
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709778 to: 1709816
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 2 from: 5243400 to: 5243438
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 2 from: 4618779 to: 4618817
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 2 from: 4224469 to: 4224507
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 2 from: 3013761 to: 3013799
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 2 from: 3256965 to: 3257003
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244437 to: 3244475
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1145547 to: 1145582
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 2 from: 2001483 to: 2001521
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 2 from: 2056492 to: 2056533
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 2 from: 1939464 to: 1939502
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65027 to: 65065
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 2 from: 1546 to: 1581
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 2 from: 3115827 to: 3115865
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534114 to: 1534152
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 2 from: 3094506 to: 3094544
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905662 to: 905700
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 2 from: 1017561 to: 1017599
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 2 from: 745417 to: 745455
gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190686 to: 190724
gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 2 from: 44770 to: 44808
gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 2 from: 144117 to: 144155
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745849 to: 7745887
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401997 to: 2402035
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183384 to: 183422
gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 2 from: 8465 to: 8503
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122460 to: 122498
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834634 to: 1834672
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 4 from: 3000800 to: 3000835
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131764 to: 2131802
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476987 to: 1477025
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143857 to: 143895
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 2 from: 234584 to: 234622
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 2 from: 401537 to: 401572
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 2 from: 233309 to: 233347
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 2 from: 1650961 to: 1650996
gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358106 to: 1358144
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 2 from: 1208203 to: 1208238
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 2 from: 1268936 to: 1268971
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 2 from: 1492802 to: 1492837
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 2 from: 692405 to: 692440
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 2 from: 631895 to: 631930
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 2 from: 156360 to: 156395
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081115 to: 1081153
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10477 to: 10515
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13862 to: 13900
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 2 from: 1610 to: 1648
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 2 from: 1449 to: 1487
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 2 from: 1629540 to: 1629575
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 2 from: 1598146 to: 1598181
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 2 from: 1560684 to: 1560719
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 2 from: 572088 to: 572123
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 2 from: 1152867 to: 1152902
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 2 from: 1026518 to: 1026553
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 2 from: 1043489 to: 1043524
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 2 from: 1029103 to: 1029138
gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4498 to: 4536
gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2521326 to: 2521364
gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 2553776 to: 2553814
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 2 from: 734897 to: 734932
gi-nr: gi|46915408 gi_def: Photobacterium profundum SS9 chromosome 2; segment 2/7 hsp_num: 2 from: 233401 to: 233436
gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438197 to: 2438235
gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224723 to: 2224761
gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107227 to: 2107265
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877871 to: 877909
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824167 to: 824205
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715250 to: 715288
gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048803 to: 1048841
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 2 from: 1575587 to: 1575622
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415154 to: 2415192


Query-DNA-Entry-Section

Query-DNA-Def dare_146|beg|622|length|136|forward|gi
Query_DNA-Sequence
agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagataacgcttacatcacaatTcgagTttgaacaccaacaacgaagttg

Coding-DNA-Entry-Section

Coding-DNA
agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagata
Protein-Sequence
LSSAILVIRPTRPPEVNTSSPLPRSHQVLCS
Hit-Information Section
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3513152 to: 3513214
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3199225 to: 3199287
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3552270 to: 3552332
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803193 to: 803255
gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 2 from: 237 to: 299
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984660 to: 2984722
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1050578 to: 1050640
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123438 to: 1123500
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123150 to: 1123212
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169241 to: 1169303
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460332 to: 460391
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 491249 to: 491308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847903 to: 2847962
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443429 to: 443488
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 391054 to: 391113
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494947 to: 495006
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441840 to: 441899
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356955 to: 357014
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426681 to: 426740
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426681 to: 426740
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501648 to: 501707
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 482 to: 541
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 900 to: 959
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 356090 to: 356149
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 491086 to: 491145
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 491088 to: 491147
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6907 to: 6966
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316393 to: 316452
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316428 to: 316487
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412551 to: 412610
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1535 to: 1594
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1536 to: 1595
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 2555010 to: 2555066
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 400192 to: 400251
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274342 to: 1274404
gi-nr: gi|15375120 gi_def: Homo sapiens chromosome 5 clone CTC-345M13, complete sequence hsp_num: 3 from: 16079 to: 16111
gi-nr: gi|28827861 gi_def: Homo sapiens chromosome 5 clone RP11-639O24, complete sequence hsp_num: 3 from: 101163 to: 101195
gi-nr: gi|28626633 gi_def: Homo sapiens chromosome 5 clone RP11-826N14, complete sequence hsp_num: 3 from: 125645 to: 125677
gi-nr: gi|29569240 gi_def: Homo sapiens chromosome 5 clone RP11-1026M7, complete sequence hsp_num: 3 from: 60757 to: 60789
gi-nr: gi|156086979 gi_def: Babesia bovis hypothetical protein (BBOV_IV009750) mRNA, complete cds hsp_num: 1 from: 26 to: 58
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 511714 to: 511773
gi-nr: gi|3046306 gi_def: Homo sapiens BAC clone CTA-459N13 from 7, complete sequence hsp_num: 2 from: 32424 to: 32456
gi-nr: gi|90075875 gi_def: Macaca fascicularis brain cDNA clone: QmoA-11424, similar to human retinol dehydrogenase 11 (all-trans and 9-cis) (RDH11), mRNA, RefSeq: NM_016026.2 hsp_num: 2 from: 1573 to: 1605
gi-nr: gi|154240756 gi_def: Macaca mulatta BAC CH250-65J15 () complete sequence hsp_num: 2 from: 26956 to: 26988
gi-nr: gi|77681789 gi_def: Colobus guereza clone CH272-362P12, complete sequence hsp_num: 2 from: 39823 to: 39855

Coding-DNA
agaacacaaaacctgatggctgcgaggcaaaggtgacgaagtgttgacctctggtggtctagtgggtcgtatcactaagattgctgaagata
Protein-Sequence
LSSAILVIRPTRPPEVNTSSPLPRSHQVLCS
Hit-Information Section
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3513152 to: 3513214
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3199225 to: 3199287
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3552270 to: 3552332
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803193 to: 803255
gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 2 from: 237 to: 299
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984660 to: 2984722
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1050578 to: 1050640
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123438 to: 1123500
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123150 to: 1123212
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169241 to: 1169303
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460332 to: 460391
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 491249 to: 491308
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2847903 to: 2847962
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443429 to: 443488
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 391054 to: 391113
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494947 to: 495006
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441840 to: 441899
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356955 to: 357014
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426681 to: 426740
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426681 to: 426740
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501648 to: 501707
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 482 to: 541
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 900 to: 959
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 356090 to: 356149
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 491086 to: 491145
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 491088 to: 491147
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6907 to: 6966
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316393 to: 316452
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316428 to: 316487
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412551 to: 412610
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1535 to: 1594
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1536 to: 1595
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 2 from: 2555010 to: 2555066
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 400192 to: 400251
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274342 to: 1274404
gi-nr: gi|15375120 gi_def: Homo sapiens chromosome 5 clone CTC-345M13, complete sequence hsp_num: 3 from: 16079 to: 16111
gi-nr: gi|28827861 gi_def: Homo sapiens chromosome 5 clone RP11-639O24, complete sequence hsp_num: 3 from: 101163 to: 101195
gi-nr: gi|28626633 gi_def: Homo sapiens chromosome 5 clone RP11-826N14, complete sequence hsp_num: 3 from: 125645 to: 125677
gi-nr: gi|29569240 gi_def: Homo sapiens chromosome 5 clone RP11-1026M7, complete sequence hsp_num: 3 from: 60757 to: 60789
gi-nr: gi|156086979 gi_def: Babesia bovis hypothetical protein (BBOV_IV009750) mRNA, complete cds hsp_num: 1 from: 26 to: 58
gi-nr: gi|145301903 gi_def: Salinispora tropica CNB-440, complete genome hsp_num: 1 from: 511714 to: 511773
gi-nr: gi|3046306 gi_def: Homo sapiens BAC clone CTA-459N13 from 7, complete sequence hsp_num: 2 from: 32424 to: 32456
gi-nr: gi|90075875 gi_def: Macaca fascicularis brain cDNA clone: QmoA-11424, similar to human retinol dehydrogenase 11 (all-trans and 9-cis) (RDH11), mRNA, RefSeq: NM_016026.2 hsp_num: 2 from: 1573 to: 1605
gi-nr: gi|154240756 gi_def: Macaca mulatta BAC CH250-65J15 () complete sequence hsp_num: 2 from: 26956 to: 26988
gi-nr: gi|77681789 gi_def: Colobus guereza clone CH272-362P12, complete sequence hsp_num: 2 from: 39823 to: 39855


Query-DNA-Entry-Section

Query-DNA-Def dare_150|beg|2054|length|140|forward|gi
Query_DNA-Sequence
cgtaacttTccgtattactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcagaa

Coding-DNA-Entry-Section

Coding-DNA
tactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcag
Protein-Sequence
LLGLISPEKRITFALLLRAGALIAPIFYRRRAHHWSINGSAE
Hit-Information Section
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284598 to: 2284636
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2728875 to: 2728919
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362236 to: 3362274
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274240 to: 3274278
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667061 to: 1667099
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240039 to: 3240077
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683717 to: 1683755
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732763 to: 1732801
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612289 to: 1612327
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881657 to: 2881695
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649660 to: 2649698
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244731 to: 3244775
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494046 to: 3494084
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1636569 to: 1636607
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153390 to: 1153428
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 2 from: 1515027 to: 1515065
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 2 from: 1241139 to: 1241177
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65318 to: 65356
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 960878 to: 960916
gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 2 from: 1283075 to: 1283113
gi-nr: gi|157129741 gi_def: Aedes aegypti hypothetical protein (AaeL_AAEL011574) mRNA, complete cds hsp_num: 1 from: 29 to: 70

Coding-DNA
tactgggattgaTttcaccggagaagcgcataaccttTgctctgctattgcgtgccggtgctttgattgcgccaaTtttctatcgtcgaagagcgcaccattggtccatcaatgggtcagcag
Protein-Sequence
LLGLISPEKRITFALLLRAGALIAPIFYRRRAHHWSINGSAE
Hit-Information Section
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2284598 to: 2284636
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2728875 to: 2728919
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3362236 to: 3362274
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3274240 to: 3274278
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667061 to: 1667099
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240039 to: 3240077
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683717 to: 1683755
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732763 to: 1732801
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612289 to: 1612327
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881657 to: 2881695
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649660 to: 2649698
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244731 to: 3244775
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494046 to: 3494084
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1636569 to: 1636607
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1153390 to: 1153428
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 2 from: 1515027 to: 1515065
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 2 from: 1241139 to: 1241177
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 2 from: 65318 to: 65356
gi-nr: gi|71061822 gi_def: Candidatus Pelagibacter ubique HTCC1062, complete genome hsp_num: 2 from: 960878 to: 960916
gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 2 from: 1283075 to: 1283113
gi-nr: gi|157129741 gi_def: Aedes aegypti hypothetical protein (AaeL_AAEL011574) mRNA, complete cds hsp_num: 1 from: 29 to: 70


Query-DNA-Entry-Section

Query-DNA-Def dare_154|beg|1304|length|122|forward|gi
Query_DNA-Sequence
agtgatctgcgtTgacgagaaaattcgttaccgcgcgatcccgtccattatcggatgcggttgaagtgacccctgcTgtgatgccgagcagcttgcgcaaactaagctgcttctggagtcga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_156|beg|1155|length|127|forward|gi
Query_DNA-Sequence
ctccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcgatggaaaaattggtc

Coding-DNA-Entry-Section

Coding-DNA
tccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcga
Protein-Sequence
PSRLYWLESIGAAPMKLGLDLRGGVHFLDGSGYGLPR
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129766 to: 129834
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439827 to: 439910
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754858 to: 754941
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803790 to: 2803873
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901406 to: 1901489
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617256 to: 617339
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057596 to: 1057679
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205275 to: 2205343
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 3306760 to: 3306828
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1203686 to: 1203754
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267382 to: 1267465
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1190601 to: 1190669
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1245355 to: 1245423
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1182993 to: 1183061
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285492 to: 2285575
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245631 to: 3245714
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376669 to: 3376752
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766291 to: 2766374
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1218292 to: 1218360
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40103 to: 40186
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085500 to: 1085568
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3878201 to: 3878269
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055309 to: 1055377
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552313 to: 552381
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534232 to: 534300
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622161 to: 1622244
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241638 to: 2241721
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219097 to: 2219180
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245604 to: 2245687
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628138 to: 628206
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695473 to: 2695556
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419582 to: 1419650
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126490 to: 1126558
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6355 to: 6423
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940738 to: 940821
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 969331 to: 969399
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11887 to: 11955
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 300836 to: 300904
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 45337 to: 45405
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868880 to: 1868948
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 693551 to: 693619
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 633041 to: 633109
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 367 to: 435
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446917 to: 1446982
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793456 to: 793521
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 2 from: 888324 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 2 from: 64360 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 2 from: 177545 to: 177589
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 2 from: 46424 to: 46468
gi-nr: gi|5353753 gi_def: Mus musculus damage-specific DNA binding protein 1 (DDB1) mRNA, complete cds hsp_num: 1 from: 3961 to: 3987
gi-nr: gi|16197725 gi_def: Mus musculus mRNA for damaged-DNA recognition protein 1 (Ddb1 gene) hsp_num: 1 from: 3993 to: 4019
gi-nr: gi|16307147 gi_def: Mus musculus damage specific DNA binding protein 1, mRNA (cDNA clone MGC:6603 IMAGE:3487617), complete cds hsp_num: 1 from: 4008 to: 4034
gi-nr: gi|74178493 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630016N21 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4027 to: 4053
gi-nr: gi|74215028 gi_def: Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730320K18 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4041 to: 4067
gi-nr: gi|74138854 gi_def: Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length enriched library, clone:I920020C16 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4059 to: 4085
gi-nr: gi|74196165 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630116E15 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4082 to: 4108
gi-nr: gi|74182144 gi_def: Mus musculus activated spleen cDNA, RIKEN full-length enriched library, clone:F830219B01 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4081 to: 4107

Coding-DNA
tccttcacgccTatattggctagagtcaattggtgctgcaccaatgaaactcggccttgatctgcgtggtggtgtgcacttccTtgatggaagtggatatggaTtgccgcga
Protein-Sequence
PSRLYWLESIGAAPMKLGLDLRGGVHFLDGSGYGLPR
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129766 to: 129834
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439827 to: 439910
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754858 to: 754941
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803790 to: 2803873
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901406 to: 1901489
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617256 to: 617339
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057596 to: 1057679
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205275 to: 2205343
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 3 from: 3306760 to: 3306828
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 3 from: 1203686 to: 1203754
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267382 to: 1267465
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 3 from: 1190601 to: 1190669
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1245355 to: 1245423
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 3 from: 1182993 to: 1183061
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285492 to: 2285575
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245631 to: 3245714
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3376669 to: 3376752
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766291 to: 2766374
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1218292 to: 1218360
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40103 to: 40186
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085500 to: 1085568
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3878201 to: 3878269
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055309 to: 1055377
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 552313 to: 552381
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534232 to: 534300
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622161 to: 1622244
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241638 to: 2241721
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219097 to: 2219180
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245604 to: 2245687
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628138 to: 628206
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695473 to: 2695556
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419582 to: 1419650
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1126490 to: 1126558
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6355 to: 6423
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940738 to: 940821
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 969331 to: 969399
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11887 to: 11955
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 300836 to: 300904
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 45337 to: 45405
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868880 to: 1868948
gi-nr: gi|146313784 gi_def: Vibrio cholerae O395 chromosome 1, complete genome hsp_num: 1 from: 693551 to: 693619
gi-nr: gi|12057213 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence hsp_num: 1 from: 633041 to: 633109
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 367 to: 435
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446917 to: 1446982
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 793456 to: 793521
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 2 from: 888324 to: 888368
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 2 from: 64360 to: 64404
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 2 from: 177545 to: 177589
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 2 from: 46424 to: 46468
gi-nr: gi|5353753 gi_def: Mus musculus damage-specific DNA binding protein 1 (DDB1) mRNA, complete cds hsp_num: 1 from: 3961 to: 3987
gi-nr: gi|16197725 gi_def: Mus musculus mRNA for damaged-DNA recognition protein 1 (Ddb1 gene) hsp_num: 1 from: 3993 to: 4019
gi-nr: gi|16307147 gi_def: Mus musculus damage specific DNA binding protein 1, mRNA (cDNA clone MGC:6603 IMAGE:3487617), complete cds hsp_num: 1 from: 4008 to: 4034
gi-nr: gi|74178493 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630016N21 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4027 to: 4053
gi-nr: gi|74215028 gi_def: Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F730320K18 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4041 to: 4067
gi-nr: gi|74138854 gi_def: Mus musculus 17 days pregnant adult female amnion cDNA, RIKEN full-length enriched library, clone:I920020C16 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4059 to: 4085
gi-nr: gi|74196165 gi_def: Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length enriched library, clone:F630116E15 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4082 to: 4108
gi-nr: gi|74182144 gi_def: Mus musculus activated spleen cDNA, RIKEN full-length enriched library, clone:F830219B01 product:damage specific DNA binding protein 1, full insert sequence hsp_num: 1 from: 4081 to: 4107


Query-DNA-Entry-Section

Query-DNA-Def dare_157|beg|1591|length|119|forward|gi
Query_DNA-Sequence
acgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaagc

Coding-DNA-Entry-Section

Coding-DNA
cgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaa
Protein-Sequence
TPRLRHVSLVELPGVQDTARAKEILGATATLEFREVDDK
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058055 to: 1058147
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287323 to: 287415
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439359 to: 439451
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755317 to: 755409
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617715 to: 617807
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204807 to: 2204899
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130207 to: 130293
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245166 to: 3245258
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337008 to: 337097
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362671 to: 3362763
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882092 to: 2882184
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274675 to: 3274767
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732274 to: 1732366
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666572 to: 1666664
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683228 to: 1683320
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611800 to: 1611892
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285033 to: 2285125
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240474 to: 3240566
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940282 to: 940374
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636080 to: 1636172
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714464 to: 714556
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650095 to: 2650187
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803328 to: 2803417
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901862 to: 1901951
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695011 to: 2695097
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2076 to: 2165
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073303 to: 1073395
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59160 to: 59252
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494481 to: 3494573
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729310 to: 2729402
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504370 to: 1504456
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170200 to: 1170286
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554025 to: 2554111
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461290 to: 461376
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492207 to: 492293
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332587 to: 332673
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846918 to: 2847004
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512167 to: 3512253
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401149 to: 401235
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153837 to: 1153923
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726001 to: 726087
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354757 to: 354843
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977821 to: 977907
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198240 to: 3198326
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437416 to: 3437502
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695376 to: 2695468
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444387 to: 444473
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551285 to: 3551371
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804154 to: 804240
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446455 to: 1446547
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392012 to: 392098
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495905 to: 495991
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 769 to: 855
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983675 to: 2983761
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051539 to: 1051625
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124399 to: 1124485
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442798 to: 442884
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357913 to: 357999
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556696 to: 1556782
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427639 to: 427725
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427639 to: 427725
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12473 to: 12559
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502606 to: 502692
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1858 to: 1944
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357048 to: 357134
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124111 to: 1124197
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275303 to: 1275389
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56965 to: 57051
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204304 to: 204390
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492044 to: 492130
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409862 to: 2409948
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525710 to: 2525796
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507591 to: 507677
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269474 to: 269560
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492046 to: 492132
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7865 to: 7951
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315408 to: 315494
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317386 to: 317472
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413509 to: 413595
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235617 to: 1235703
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463720 to: 1463806
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480030 to: 1480113
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420026 to: 1420112
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628576 to: 628668
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110157 to: 1110243
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145475 to: 1145561
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531439 to: 3531528
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533770 to: 533859
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317771 to: 4317860
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233798 to: 233887
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63898 to: 63987
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177083 to: 177172
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45962 to: 46051
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232523 to: 232612
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240689 to: 1240778
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853341 to: 1853427
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482491 to: 4482580
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261536 to: 4261625
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140880 to: 4140969
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169618 to: 5169707
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928777 to: 4928866
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621699 to: 1621788
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267841 to: 1267918
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241176 to: 2241265
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218635 to: 2218724
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245142 to: 2245231
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597467 to: 4597544
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164667 to: 3164744
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308555 to: 1308632
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987153 to: 987230
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248322 to: 1248399
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278093 to: 4278170
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055750 to: 1055827
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218230 to: 5218307
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724795 to: 5724872
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972487 to: 972564
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877751 to: 3877828
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279388 to: 3279465
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1349 to: 1426
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8227 to: 8304
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1457 to: 1534
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514199 to: 1514276
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388784 to: 1388861
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555408 to: 1555485
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990378 to: 2990452
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44899 to: 44973

Coding-DNA
cgccaaggtTgcgacacgtatcgtTggtagagctgccgggtgtacaagatacagcgcgtgctaaagaaatcttaggcgcgaccgcaacccttgaatttcgtgaagtggacgataaa
Protein-Sequence
TPRLRHVSLVELPGVQDTARAKEILGATATLEFREVDDK
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058055 to: 1058147
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 287323 to: 287415
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439359 to: 439451
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755317 to: 755409
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617715 to: 617807
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204807 to: 2204899
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130207 to: 130293
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245166 to: 3245258
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337008 to: 337097
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362671 to: 3362763
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882092 to: 2882184
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274675 to: 3274767
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732274 to: 1732366
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666572 to: 1666664
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683228 to: 1683320
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611800 to: 1611892
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285033 to: 2285125
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240474 to: 3240566
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940282 to: 940374
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636080 to: 1636172
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714464 to: 714556
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650095 to: 2650187
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803328 to: 2803417
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901862 to: 1901951
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695011 to: 2695097
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2076 to: 2165
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073303 to: 1073395
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59160 to: 59252
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494481 to: 3494573
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729310 to: 2729402
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504370 to: 1504456
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170200 to: 1170286
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554025 to: 2554111
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461290 to: 461376
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492207 to: 492293
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332587 to: 332673
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846918 to: 2847004
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512167 to: 3512253
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401149 to: 401235
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153837 to: 1153923
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 726001 to: 726087
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354757 to: 354843
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977821 to: 977907
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198240 to: 3198326
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437416 to: 3437502
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695376 to: 2695468
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444387 to: 444473
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551285 to: 3551371
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804154 to: 804240
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446455 to: 1446547
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 392012 to: 392098
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495905 to: 495991
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 769 to: 855
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983675 to: 2983761
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051539 to: 1051625
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124399 to: 1124485
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442798 to: 442884
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357913 to: 357999
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556696 to: 1556782
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427639 to: 427725
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427639 to: 427725
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12473 to: 12559
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502606 to: 502692
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1858 to: 1944
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357048 to: 357134
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124111 to: 1124197
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275303 to: 1275389
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56965 to: 57051
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204304 to: 204390
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 492044 to: 492130
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409862 to: 2409948
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525710 to: 2525796
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507591 to: 507677
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 269474 to: 269560
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 769 to: 855
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 492046 to: 492132
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7865 to: 7951
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315408 to: 315494
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317386 to: 317472
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413509 to: 413595
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1235617 to: 1235703
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463720 to: 1463806
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480030 to: 1480113
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420026 to: 1420112
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628576 to: 628668
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110157 to: 1110243
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145475 to: 1145561
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3531439 to: 3531528
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533770 to: 533859
gi-nr: gi|89343559 gi_def: Rhodoferax ferrireducens DSM 15236, complete genome hsp_num: 1 from: 4317771 to: 4317860
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233798 to: 233887
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63898 to: 63987
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 177083 to: 177172
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45962 to: 46051
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232523 to: 232612
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240689 to: 1240778
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853341 to: 1853427
gi-nr: gi|121551644 gi_def: Verminephrobacter eiseniae EF01-2, complete genome hsp_num: 1 from: 4482491 to: 4482580
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4261536 to: 4261625
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 4140880 to: 4140969
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5169618 to: 5169707
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 4928777 to: 4928866
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621699 to: 1621788
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267841 to: 1267918
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241176 to: 2241265
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218635 to: 2218724
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245142 to: 2245231
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597467 to: 4597544
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164667 to: 3164744
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308555 to: 1308632
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987153 to: 987230
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248322 to: 1248399
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278093 to: 4278170
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055750 to: 1055827
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218230 to: 5218307
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724795 to: 5724872
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 972487 to: 972564
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877751 to: 3877828
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279388 to: 3279465
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1349 to: 1426
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2065 to: 2142
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8227 to: 8304
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1457 to: 1534
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514199 to: 1514276
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388784 to: 1388861
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555408 to: 1555485
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990378 to: 2990452
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44899 to: 44973


Query-DNA-Entry-Section

Query-DNA-Def dare_160|beg|2285|length|129|forward|gi
Query_DNA-Sequence
atcgcactaatTggcgaaccTtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcgatgccaacg

Coding-DNA-Entry-Section

Coding-DNA
tcgcactaatTggcgaaccTtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcga
Protein-Sequence
IDRHYRPSTRYQQYPARSMVAPGIIDITPMINTKGSPISA
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130896 to: 130955
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618404 to: 618463
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204151 to: 2204210
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058744 to: 1058803

Coding-DNA
TtTcgtgttgatcattggcgtaatgtcgatgatcccgggcgcaaccatTgaccttgccgggtattgctggtatcgtgttgacggtcggtaatggcggtcga
Protein-Sequence
HRPPLPTVNTIPAIPGKVNGCARDHRHYANDQHER
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 1 from: 1465 to: 1512
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 1 from: 288013 to: 288060
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 2 from: 797303 to: 797350
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 2 from: 190 to: 231
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130944 to: 130985
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618452 to: 618493
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204121 to: 2204162
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 3 from: 1146212 to: 1146253
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058792 to: 1058833
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 4 from: 756054 to: 756095
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438673 to: 438714
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 337745 to: 337789
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 4 from: 2284350 to: 2284394
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 3 from: 2694690 to: 2694734
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361988 to: 3362032
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273992 to: 3274036
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881409 to: 2881453
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3305663 to: 3305707
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 3 from: 1480761 to: 1480805
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667303 to: 1667347
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 5 from: 1191749 to: 1191793
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612531 to: 1612575
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 3 from: 3239791 to: 3239832
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 3 from: 1683959 to: 1684003
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733005 to: 1733049
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1204807 to: 1204851
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 3 from: 2728627 to: 2728671
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 3 from: 3244483 to: 3244527
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 3 from: 1636811 to: 1636855
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 3 from: 2649412 to: 2649456
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 3 from: 1503 to: 1541
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 3 from: 1124845 to: 1124883
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 3 from: 3511481 to: 3511519
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 3 from: 2982989 to: 2983027
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 3 from: 3550599 to: 3550637
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 3 from: 3436733 to: 3436768
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 3 from: 1125133 to: 1125171
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 3 from: 804888 to: 804926
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 3 from: 1052273 to: 1052311
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 3 from: 3197554 to: 3197592
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445763 to: 1445807
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217153 to: 1217194
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 124156 to: 124179
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 3 from: 1674853 to: 1674885
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084361 to: 1084402
gi-nr: gi|37509038 gi_def: Vibrio vulnificus YJ016 DNA, chromosome II, complete sequence hsp_num: 1 from: 1334566 to: 1334610
gi-nr: gi|27362712 gi_def: Vibrio vulnificus CMCP6 chromosome II, complete sequence hsp_num: 1 from: 797610 to: 797654
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240487 to: 2240528
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217946 to: 2217987
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44770 to: 44814


Query-DNA-Entry-Section

Query-DNA-Def dare_163|beg|2831|length|111|forward|gi
Query_DNA-Sequence
gggggctggatttcacggcggtactttgattgaagtTgggctttgaacagcctgccaatctggagTcaaatccgtagcgcccttgaagcgaaaggttttggtgatgctacc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_164|beg|1149|length|105|forward|gi
Query_DNA-Sequence
acctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtgg

Coding-DNA-Entry-Section

Coding-DNA
cctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtg
Protein-Sequence
LAPSTPYWLESIGAAPMKLLALDLRGGVHFLMEV
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 313 to: 369
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 12 from: 367 to: 411
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796151 to: 796207
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 286861 to: 286917
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754852 to: 754908
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754906 to: 754950
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439860 to: 439916
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439818 to: 439862
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803823 to: 2803879
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803781 to: 2803825
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057590 to: 1057646
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057644 to: 1057688
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617250 to: 617306
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617304 to: 617348
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479628 to: 1479672
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650551 to: 2650595
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 5 from: 3001931 to: 3001975
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1666164 to: 1666208
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1682820 to: 1682864
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901400 to: 1901456
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901454 to: 1901498
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1731812 to: 1731868
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1731866 to: 1731910
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1203719 to: 1203763
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1611392 to: 1611436
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882590 to: 2882646
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2882548 to: 2882592
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3306751 to: 3306795
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729808 to: 2729864
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729810
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 2 from: 4597911 to: 4597955
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494937 to: 3494981
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 6 from: 4144619 to: 4144663
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3363127 to: 3363171
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3275131 to: 3275175
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3811454 to: 3811498
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240930 to: 3240974
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205308 to: 2205364
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2205266 to: 2205310
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 961190 to: 961234
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245664 to: 3245720
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245622 to: 3245666
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1144410 to: 1144454
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285525 to: 2285581
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2285483 to: 2285527
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635672 to: 1635716
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695880 to: 2695936
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2695838 to: 2695882
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1109755 to: 1109799
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 367 to: 411
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1267430 to: 1267474
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376717 to: 3376761
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 578392 to: 578436
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 57409 to: 57453
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129745 to: 129801
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 129799 to: 129843
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123709 to: 1123753
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512611 to: 3512655
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 3437860 to: 3437904
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984119 to: 2984163
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551729 to: 3551773
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123997 to: 1124041
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803752 to: 803796
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051137 to: 1051181
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977365 to: 977421
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 977419 to: 977463
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198684 to: 3198728
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169798 to: 1169842
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274901 to: 1274945
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279871 to: 3279927
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279829 to: 3279873
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847362 to: 2847406
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 40151 to: 40195
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1456 to: 1500
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491644 to: 491688
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491642 to: 491686
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502204 to: 502248
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443985 to: 444029
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442396 to: 442440
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460888 to: 460932
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495503 to: 495547
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413107 to: 413151
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554469 to: 2554513
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427237 to: 427281
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491805 to: 491849
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427237 to: 427281
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357511 to: 357555
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356646 to: 356690
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391610 to: 391654
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316984 to: 317028
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315852 to: 315896
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7463 to: 7507
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526154 to: 2526198
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507189 to: 507233
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410306 to: 2410350
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1218283 to: 1218327
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1085491 to: 1085535
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203902 to: 203946
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12071 to: 12115
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400747 to: 400791
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622197 to: 1622250
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622152 to: 1622190
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245640 to: 2245693
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245595 to: 2245633
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241674 to: 2241727
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241629 to: 2241667
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219133 to: 2219186
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219088 to: 2219126
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695508
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990816 to: 2990860
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394869 to: 394913
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 714062 to: 714106
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301236 to: 301280
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1154281 to: 1154319
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556240 to: 1556293
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1556300 to: 1556338
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766326
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2523 to: 2561
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1823608 to: 1823652
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 2 from: 552346 to: 552390
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 2 from: 1463324 to: 1463362
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628171 to: 628215
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 2 from: 6388 to: 6432
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853794 to: 1853838
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1504814 to: 1504852
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940773
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308147 to: 1308191
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1247914 to: 1247958
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1126481 to: 1126525
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1235221 to: 1235259
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 2 from: 333031 to: 333069
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 2 from: 726445 to: 726483
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 2 from: 269918 to: 269956
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 2 from: 354361 to: 354399
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11920 to: 11964
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145073 to: 1145117
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59654
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 2 from: 45328 to: 45372
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240281 to: 1240325
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514169 to: 1514213
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534267
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446908 to: 1446952
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073794
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868913 to: 1868957
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 2 from: 2172252 to: 2172296
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417892 to: 1417936
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 400 to: 444
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419615 to: 1419659
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 2 from: 300869 to: 300913
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2920991 to: 2921035
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 831986 to: 832030
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526506 to: 526550

Coding-DNA
cctcgctccttcaacgccatattggctagagtcaattggtgctgcaccaatgaaactTcTggcccttgatctgcgtggtggtgtgcacttcctgatggaagtg
Protein-Sequence
LAPSTPYWLESIGAAPMKLLALDLRGGVHFLMEV
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 313 to: 369
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 12 from: 367 to: 411
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796151 to: 796207
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 286861 to: 286917
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754852 to: 754908
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 754906 to: 754950
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439860 to: 439916
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439818 to: 439862
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803823 to: 2803879
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 2803781 to: 2803825
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057590 to: 1057646
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057644 to: 1057688
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617250 to: 617306
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617304 to: 617348
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 2 from: 1479628 to: 1479672
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2650551 to: 2650595
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 5 from: 3001931 to: 3001975
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1666164 to: 1666208
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1682820 to: 1682864
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901400 to: 1901456
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 1901454 to: 1901498
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1731812 to: 1731868
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1731866 to: 1731910
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 5 from: 1203719 to: 1203763
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1611392 to: 1611436
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882590 to: 2882646
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2882548 to: 2882592
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 5 from: 3306751 to: 3306795
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729808 to: 2729864
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 2 from: 2729766 to: 2729810
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 2 from: 4597911 to: 4597955
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3494937 to: 3494981
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 6 from: 4144619 to: 4144663
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3363127 to: 3363171
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3275131 to: 3275175
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 5 from: 3811454 to: 3811498
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3240930 to: 3240974
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205308 to: 2205364
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2205266 to: 2205310
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 961190 to: 961234
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245664 to: 3245720
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3245622 to: 3245666
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 4 from: 1144410 to: 1144454
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285525 to: 2285581
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 2 from: 2285483 to: 2285527
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 2 from: 1635672 to: 1635716
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695880 to: 2695936
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2695838 to: 2695882
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1109755 to: 1109799
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 367 to: 411
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 2 from: 1267430 to: 1267474
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 2 from: 3376717 to: 3376761
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 2 from: 578392 to: 578436
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 57409 to: 57453
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129745 to: 129801
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 129799 to: 129843
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 2 from: 1123709 to: 1123753
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 2 from: 3512611 to: 3512655
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 2 from: 3437860 to: 3437904
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 2 from: 2984119 to: 2984163
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 2 from: 3551729 to: 3551773
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 2 from: 1123997 to: 1124041
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 2 from: 803752 to: 803796
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 2 from: 1051137 to: 1051181
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977365 to: 977421
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 977419 to: 977463
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 2 from: 3198684 to: 3198728
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 2 from: 1169798 to: 1169842
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1274901 to: 1274945
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279871 to: 3279927
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 2 from: 3279829 to: 3279873
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847362 to: 2847406
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 2 from: 40151 to: 40195
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1456 to: 1500
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491644 to: 491688
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491642 to: 491686
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502204 to: 502248
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443985 to: 444029
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442396 to: 442440
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460888 to: 460932
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495503 to: 495547
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413107 to: 413151
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554469 to: 2554513
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427237 to: 427281
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491805 to: 491849
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427237 to: 427281
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357511 to: 357555
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356646 to: 356690
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391610 to: 391654
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316984 to: 317028
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315852 to: 315896
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 367 to: 411
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7463 to: 7507
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526154 to: 2526198
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507189 to: 507233
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410306 to: 2410350
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 2 from: 1218283 to: 1218327
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 2 from: 1085491 to: 1085535
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203902 to: 203946
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12071 to: 12115
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400747 to: 400791
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1622197 to: 1622250
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 2 from: 1622152 to: 1622190
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245640 to: 2245693
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 2 from: 2245595 to: 2245633
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241674 to: 2241727
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 2 from: 2241629 to: 2241667
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2219133 to: 2219186
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 2 from: 2219088 to: 2219126
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695464 to: 2695508
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990816 to: 2990860
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 394869 to: 394913
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 2 from: 714062 to: 714106
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301236 to: 301280
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 2 from: 1154281 to: 1154319
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1556240 to: 1556293
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 2 from: 1556300 to: 1556338
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2766282 to: 2766326
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2523 to: 2561
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 2 from: 1823608 to: 1823652
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 2 from: 552346 to: 552390
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 2 from: 1463324 to: 1463362
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628171 to: 628215
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 2 from: 6388 to: 6432
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853794 to: 1853838
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 2 from: 1504814 to: 1504852
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940729 to: 940773
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 2 from: 1308147 to: 1308191
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 2 from: 1247914 to: 1247958
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 2 from: 1126481 to: 1126525
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 2 from: 1235221 to: 1235259
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 2 from: 333031 to: 333069
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 2 from: 726445 to: 726483
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 2 from: 269918 to: 269956
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 2 from: 354361 to: 354399
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 11920 to: 11964
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 2 from: 1145073 to: 1145117
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59610 to: 59654
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 2 from: 45328 to: 45372
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1240281 to: 1240325
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1514169 to: 1514213
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 534223 to: 534267
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1446908 to: 1446952
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073750 to: 1073794
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1868913 to: 1868957
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 2 from: 2172252 to: 2172296
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1417892 to: 1417936
gi-nr: gi|113707294 gi_def: Synthetic construct Vibrio cholerae clone FLH197767.01F secD-2 gene, complete sequence hsp_num: 1 from: 400 to: 444
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419615 to: 1419659
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 2 from: 300869 to: 300913
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2920991 to: 2921035
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 831986 to: 832030
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 526506 to: 526550


Query-DNA-Entry-Section

Query-DNA-Def dare_166|beg|323|length|132|forward|gi
Query_DNA-Sequence
cgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctgtgcatcccaatagaatcaacat

Coding-DNA-Entry-Section

Coding-DNA
gagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctg
Protein-Sequence
SSTRVVTAKCHHYKKTSLISCIWVGFCVVSRLNSPL
Hit-Information Section
gi-nr: gi|85099348 gi_def: Neurospora crassa OR74A hypothetical protein (NCU01255.1) partial mRNA hsp_num: 2 from: 1353 to: 1379

Coding-DNA
gagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagacaagcctgatttcgtgcaTctgggttggattttgcgtggtaagccgcttgaattcacccctg
Protein-Sequence
SSTRVVTAKCHHYKKTSLISCIWVGFCVVSRLNSPL
Hit-Information Section
gi-nr: gi|85099348 gi_def: Neurospora crassa OR74A hypothetical protein (NCU01255.1) partial mRNA hsp_num: 2 from: 1353 to: 1379


Query-DNA-Entry-Section

Query-DNA-Def dare_168|beg|1332|length|128|forward|gi
Query_DNA-Sequence
accgcgcgatccgtccattatcTggatgcggttgaagtgaccctgcgtTgatgccgagcagcttgcgcaaactaagctgcttctggTagtcgaaacaccgtgatatgacctttacgacttcagaatcc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_169|beg|684|length|142|forward|gi
Query_DNA-Sequence
tTagtgggtcgtatcactaagattgctgaagataacgcttacatcaTcaatcgagttgaacaccaaTcaacgaaTgttgtgatcaagaaggacttcgTtgactgcagtgctTaccaaaaggtacgctgaaatctcttaaaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_171|beg|2404|length|131|forward|gi
Query_DNA-Sequence
cacgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattac

Coding-DNA-Entry-Section

Coding-DNA
acgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaatt
Protein-Sequence
HVTDFSSVFVKSYAEGKNPQQAIHQGYANAFSTIADANITTLI
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438534 to: 438620
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756148 to: 756234
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 284 to: 370
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203982 to: 2204068
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131038 to: 131124
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058886 to: 1058972
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618546 to: 618632
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694551 to: 2694640
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881270 to: 2881353
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733105 to: 1733188
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244344 to: 3244427
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636911 to: 1636994
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284211 to: 2284291
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629481
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852507 to: 1852578

Coding-DNA
acgTtactgaTttttcgagcgtattcgtgaagagctacgcggaaggaaaaaatccgcagcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaatt
Protein-Sequence
HVTDFSSVFVKSYAEGKNPQQAIHQGYANAFSTIADANITTLI
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438534 to: 438620
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756148 to: 756234
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 284 to: 370
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203982 to: 2204068
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131038 to: 131124
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058886 to: 1058972
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618546 to: 618632
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694551 to: 2694640
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881270 to: 2881353
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733105 to: 1733188
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244344 to: 3244427
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636911 to: 1636994
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284211 to: 2284291
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629410 to: 629481
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852507 to: 1852578


Query-DNA-Entry-Section

Query-DNA-Def dare_175|beg|9|length|113|forward|gi
Query_DNA-Sequence
ggtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtgatcaagTatccgtaatgcagcacata

Coding-DNA-Entry-Section

Coding-DNA
gtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtg
Protein-Sequence
GVRRGIDMFDCVMPTRNALTVTYLLTGGV
Hit-Information Section
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864209 to: 1864295
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108337 to: 2108417
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889607 to: 889660
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65654 to: 65707
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178841 to: 178894
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48763 to: 48816
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688226 to: 688279
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 144 to: 194
gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906034 to: 906084
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750376 to: 750429
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299998 to: 300051
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693134 to: 693187
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803386 to: 803439
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684714 to: 684767
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254210 to: 254263
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749917 to: 749970
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295824 to: 295877
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393622 to: 393675
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899083 to: 899136
gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 1017657 to: 1017710
gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2645137 to: 2645190
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919685 to: 2919738
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200950 to: 3201003
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706163 to: 706216
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830750 to: 830803
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1419130 to: 1419183
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867724
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542945 to: 2542998
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283006 to: 3283059
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267136 to: 3267189
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191251 to: 1191304
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302241 to: 302294
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322222 to: 322275
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369764 to: 3369817
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481759 to: 481812
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527907 to: 527960
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491558 to: 2491611
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693066 to: 3693119
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079059 to: 3079112
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434264 to: 3434317
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5186538 to: 5186585
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427551 to: 1427604
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949315 to: 3949368
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 3 from: 1926424 to: 1926474
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733339 to: 733389
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59594 to: 59644
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712883 to: 712933
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3259575 to: 3259622
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4579269 to: 4579316
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992238 to: 1992291
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3117648 to: 3117695
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1973834 to: 1973881
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2917806 to: 2917853
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 2819833 to: 2819880
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 939551 to: 939601
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 2889395 to: 2889445
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1967627 to: 1967674
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3267403 to: 3267450
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4181553 to: 4181600
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535412 to: 535462
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529887 to: 3529937
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 207694 to: 207741
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 344896 to: 344952
gi-nr: gi|116096021 gi_def: Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome hsp_num: 1 from: 328812 to: 328859
gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638392 to: 1638445
gi-nr: gi|91202367 gi_def: Kuenenia stuttgartiensis genome fragment KUST_D (4 of 5) hsp_num: 1 from: 642270 to: 642317
gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354232 to: 1354285
gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14074 to: 14115
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4738382 to: 4738429
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2537240 to: 2537287
gi-nr: gi|17740104 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 150 of 256 of the complete sequence hsp_num: 1 from: 7391 to: 7438
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2217753 to: 2217800
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1664650 to: 1664697
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 2289179 to: 2289223
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1067930 to: 1067974
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 749504 to: 749548
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1502945 to: 1502989
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 944096 to: 944140
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 2 from: 1065934 to: 1065978
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1116940 to: 1116984
gi-nr: gi|39649375 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 9/16 hsp_num: 1 from: 172634 to: 172681
gi-nr: gi|17982828 gi_def: Brucella melitensis 16M chromosome I, section 86 of 195 of the complete sequence hsp_num: 1 from: 11530 to: 11574
gi-nr: gi|17982952 gi_def: Brucella melitensis 16M chromosome I, section 97 of 195 of the complete sequence hsp_num: 1 from: 9329 to: 9373
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 570238 to: 570282
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 963099 to: 963143
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 2 from: 1083279 to: 1083323
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 960219 to: 960263
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 2 from: 1080430 to: 1080474
gi-nr: gi|15667437 gi_def: Enterococcus faecium gene for tRNA-guanine transglycosylase, partial cds hsp_num: 1 from: 510 to: 557
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 128689 to: 128736
gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8487 to: 8534
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 365726 to: 365773
gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1842 to: 1889
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665903 to: 665941
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1142425 to: 1142472
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2387356 to: 2387403
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575212 to: 1575262
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2298462 to: 2298509
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 903955 to: 904002
gi-nr: gi|15620220 gi_def: Rickettsia conorii str. Malish 7, section 93 of 114 of the complete genome hsp_num: 1 from: 441 to: 488
gi-nr: gi|3861237 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 4/4 hsp_num: 1 from: 35125 to: 35172
gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199468 to: 1199518
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1349855 to: 1349902
gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 987110 to: 987154
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1586368 to: 1586412
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 270622 to: 270669
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 1310972 to: 1311016
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1362452 to: 1362499
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 1375031 to: 1375075
gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 2001719 to: 2001763
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2138207 to: 2138251
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 1604812 to: 1604856
gi-nr: gi|157128020 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL010993) mRNA, complete cds hsp_num: 1 from: 820 to: 870
gi-nr: gi|157109378 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL015117) mRNA, complete cds hsp_num: 1 from: 820 to: 870
gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1287
gi-nr: gi|58613532 gi_def: Heterocapsa triquetra clone HTQTR1 chloroplast queuine tRNA ribosyl transferase mRNA, partial cds; nuclear gene for chloroplast product hsp_num: 1 from: 398 to: 445

Coding-DNA
gtgtgcgtcgtggtatcgacatgtttgactgtgtgatgccaacgcgtaacgcactaacggtcacctatttgtTgacgggtggtgtg
Protein-Sequence
GVRRGIDMFDCVMPTRNALTVTYLLTGGV
Hit-Information Section
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864209 to: 1864295
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108337 to: 2108417
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 889607 to: 889660
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 65654 to: 65707
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 178841 to: 178894
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 48763 to: 48816
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 688226 to: 688279
gi-nr: gi|156776918 gi_def: Uncultured bacterium clone HA0AAA15ZF03RM1 genomic sequence hsp_num: 1 from: 144 to: 194
gi-nr: gi|149935098 gi_def: Parabacteroides distasonis ATCC 8503, complete genome hsp_num: 1 from: 906034 to: 906084
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 750376 to: 750429
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 299998 to: 300051
gi-nr: gi|120865607 gi_def: Neisseria meningitidis serogroup C FAM18 complete genome hsp_num: 1 from: 693134 to: 693187
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 803386 to: 803439
gi-nr: gi|115280044 gi_def: Burkholderia cepacia AMMD chromosome 1, complete sequence hsp_num: 1 from: 684714 to: 684767
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 254210 to: 254263
gi-nr: gi|66731897 gi_def: Neisseria meningitidis MC58, complete genome hsp_num: 1 from: 749917 to: 749970
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 295824 to: 295877
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393622 to: 393675
gi-nr: gi|30407145 gi_def: Neisseria meningitidis serogroup A strain Z2491 complete genome hsp_num: 1 from: 899083 to: 899136
gi-nr: gi|116123488 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis JB197 chromosome 1, complete sequence hsp_num: 1 from: 1017657 to: 1017710
gi-nr: gi|116119596 gi_def: Leptospira borgpetersenii serovar Hardjo-bovis L550 chromosome 1, complete sequence hsp_num: 1 from: 2645137 to: 2645190
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2919685 to: 2919738
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3200950 to: 3201003
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 706163 to: 706216
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 830750 to: 830803
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1419130 to: 1419183
gi-nr: gi|145046595 gi_def: Polynucleobacter sp. QLW-P1DMWA-1, complete genome hsp_num: 1 from: 1867671 to: 1867724
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 1 from: 2542945 to: 2542998
gi-nr: gi|126225085 gi_def: Burkholderia pseudomallei 1106a chromosome I, complete sequence hsp_num: 1 from: 3283006 to: 3283059
gi-nr: gi|126217846 gi_def: Burkholderia pseudomallei 668 chromosome I, complete sequence hsp_num: 1 from: 3267136 to: 3267189
gi-nr: gi|124291339 gi_def: Burkholderia mallei NCTC 10229 chromosome II, complete sequence hsp_num: 1 from: 1191251 to: 1191304
gi-nr: gi|121226989 gi_def: Burkholderia mallei SAVP1 chromosome II, complete sequence hsp_num: 1 from: 302241 to: 302294
gi-nr: gi|120591888 gi_def: Polaromonas naphthalenivorans CJ2, complete genome hsp_num: 1 from: 322222 to: 322275
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3369764 to: 3369817
gi-nr: gi|91695138 gi_def: Polaromonas sp. JS666, complete genome hsp_num: 1 from: 481759 to: 481812
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 527907 to: 527960
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 1 from: 2491558 to: 2491611
gi-nr: gi|76577973 gi_def: Burkholderia pseudomallei 1710b chromosome I, complete sequence hsp_num: 1 from: 3693066 to: 3693119
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3079059 to: 3079112
gi-nr: gi|52208053 gi_def: Burkholderia pseudomallei strain K96243, chromosome 1, complete sequence hsp_num: 1 from: 3434264 to: 3434317
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5186538 to: 5186585
gi-nr: gi|83652219 gi_def: Burkholderia thailandensis E264 chromosome I, complete sequence hsp_num: 1 from: 1427551 to: 1427604
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 3949315 to: 3949368
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 3 from: 1926424 to: 1926474
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 733339 to: 733389
gi-nr: gi|34483511 gi_def: Wolinella succinogenes, complete genome; segment 5/7 hsp_num: 1 from: 59594 to: 59644
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 712883 to: 712933
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3259575 to: 3259622
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4579269 to: 4579316
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1992238 to: 1992291
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3117648 to: 3117695
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 1973834 to: 1973881
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 2917806 to: 2917853
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 2819833 to: 2819880
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 3 from: 939551 to: 939601
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 2 from: 2889395 to: 2889445
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1967627 to: 1967674
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3267403 to: 3267450
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4181553 to: 4181600
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535412 to: 535462
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3529887 to: 3529937
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 207694 to: 207741
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 344896 to: 344952
gi-nr: gi|116096021 gi_def: Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293, complete genome hsp_num: 1 from: 328812 to: 328859
gi-nr: gi|114336511 gi_def: Syntrophomonas wolfei subsp. wolfei str. Goettingen, complete genome hsp_num: 1 from: 1638392 to: 1638445
gi-nr: gi|91202367 gi_def: Kuenenia stuttgartiensis genome fragment KUST_D (4 of 5) hsp_num: 1 from: 642270 to: 642317
gi-nr: gi|77994731 gi_def: Carboxydothermus hydrogenoformans Z-2901, complete genome hsp_num: 1 from: 1354232 to: 1354285
gi-nr: gi|82524021 gi_def: Uncultured Flavobacteriaceae bacterium fosmid clone b1bf1.10.d03 hsp_num: 1 from: 14074 to: 14115
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4738382 to: 4738429
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2537240 to: 2537287
gi-nr: gi|17740104 gi_def: Agrobacterium tumefaciens str. C58 circular chromosome, section 150 of 256 of the complete sequence hsp_num: 1 from: 7391 to: 7438
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 2217753 to: 2217800
gi-nr: gi|16445345 gi_def: Agrobacterium tumefaciens str. C58, complete genome hsp_num: 1 from: 1664650 to: 1664697
gi-nr: gi|151559234 gi_def: Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence hsp_num: 1 from: 2289179 to: 2289223
gi-nr: gi|148370077 gi_def: Brucella ovis ATCC 25840 chromosome I, complete sequence hsp_num: 1 from: 1067930 to: 1067974
gi-nr: gi|120613812 gi_def: Bartonella bacilliformis KC583, complete genome hsp_num: 1 from: 749504 to: 749548
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1502945 to: 1502989
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 1 from: 944096 to: 944140
gi-nr: gi|54112365 gi_def: Brucella suis 1330 chromosome I, complete sequence hsp_num: 2 from: 1065934 to: 1065978
gi-nr: gi|49237636 gi_def: Bartonella henselae strain Houston-1, complete genome hsp_num: 1 from: 1116940 to: 1116984
gi-nr: gi|39649375 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 9/16 hsp_num: 1 from: 172634 to: 172681
gi-nr: gi|17982828 gi_def: Brucella melitensis 16M chromosome I, section 86 of 195 of the complete sequence hsp_num: 1 from: 11530 to: 11574
gi-nr: gi|17982952 gi_def: Brucella melitensis 16M chromosome I, section 97 of 195 of the complete sequence hsp_num: 1 from: 9329 to: 9373
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 570238 to: 570282
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 1 from: 963099 to: 963143
gi-nr: gi|62195123 gi_def: Brucella abortus biovar 1 str. 9-941 chromosome I, complete sequence hsp_num: 2 from: 1083279 to: 1083323
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 1 from: 960219 to: 960263
gi-nr: gi|82615033 gi_def: Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308 hsp_num: 2 from: 1080430 to: 1080474
gi-nr: gi|15667437 gi_def: Enterococcus faecium gene for tRNA-guanine transglycosylase, partial cds hsp_num: 1 from: 510 to: 557
gi-nr: gi|148498119 gi_def: Sphingomonas wittichii RW1, complete genome hsp_num: 1 from: 128689 to: 128736
gi-nr: gi|11095417 gi_def: Zymomonas mobilis strain ZM4 fosmid 44B6 flagellar hook-basal body complex protein (FliE), flagellar M-Ring protein (FliF), flagellar motor switch protein (FliG), probable H+-transporting ATP synthase (FliI), tRNA guanine transglycosylase, DNA ligase, glucose transport protein (Glf), glucose-6-phosphate 1-dehydrogenase (Zwf), phosphogluconate dehydratase (Edd), glucokinse (Glk), aspartate racemase (Asr), Zrp (Zrp), levansucrase (LevU), extracellular sucrase (InvB), and partial ATP-dependent protease Lon genes, complete cds hsp_num: 1 from: 8487 to: 8534
gi-nr: gi|56542470 gi_def: Zymomonas mobilis subsp. mobilis ZM4, complete genome hsp_num: 1 from: 365726 to: 365773
gi-nr: gi|498139 gi_def: Zymomonas mobilis ABC excision endonuclease subunit (uvrB) gene, 3' end, tRNA guanine transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1842 to: 1889
gi-nr: gi|117576522 gi_def: Gramella forsetii KT0803 complete circular genome hsp_num: 1 from: 665903 to: 665941
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1142425 to: 1142472
gi-nr: gi|87133707 gi_def: Novosphingobium aromaticivorans DSM 12444, complete genome hsp_num: 1 from: 2387356 to: 2387403
gi-nr: gi|116222307 gi_def: Solibacter usitatus Ellin6076, complete genome hsp_num: 1 from: 1575212 to: 1575262
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 2298462 to: 2298509
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 903955 to: 904002
gi-nr: gi|15620220 gi_def: Rickettsia conorii str. Malish 7, section 93 of 114 of the complete genome hsp_num: 1 from: 441 to: 488
gi-nr: gi|3861237 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 4/4 hsp_num: 1 from: 35125 to: 35172
gi-nr: gi|116090851 gi_def: Oenococcus oeni PSU-1, complete genome hsp_num: 1 from: 1199468 to: 1199518
gi-nr: gi|91068359 gi_def: Rickettsia bellii RML369-C, complete genome hsp_num: 1 from: 1349855 to: 1349902
gi-nr: gi|78170183 gi_def: Chlorobium chlorochromatii CaD3, complete genome hsp_num: 1 from: 987110 to: 987154
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 1586368 to: 1586412
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 270622 to: 270669
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 1310972 to: 1311016
gi-nr: gi|150026743 gi_def: Sinorhizobium medicae WSM419, complete genome hsp_num: 1 from: 1362452 to: 1362499
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 1375031 to: 1375075
gi-nr: gi|119353206 gi_def: Chlorobium phaeobacteroides DSM 266, complete genome hsp_num: 1 from: 2001719 to: 2001763
gi-nr: gi|156231356 gi_def: Roseiflexus castenholzii DSM 13941, complete genome hsp_num: 1 from: 2138207 to: 2138251
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 1604812 to: 1604856
gi-nr: gi|157128020 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL010993) mRNA, complete cds hsp_num: 1 from: 820 to: 870
gi-nr: gi|157109378 gi_def: Aedes aegypti queuine tRNA-ribosyltransferase (AaeL_AAEL015117) mRNA, complete cds hsp_num: 1 from: 820 to: 870
gi-nr: gi|110765030 gi_def: PREDICTED: Apis mellifera similar to tRNA-guanine transglycosylase CG4947-PA (LOC411719), mRNA hsp_num: 1 from: 1246 to: 1287
gi-nr: gi|58613532 gi_def: Heterocapsa triquetra clone HTQTR1 chloroplast queuine tRNA ribosyl transferase mRNA, partial cds; nuclear gene for chloroplast product hsp_num: 1 from: 398 to: 445


Query-DNA-Entry-Section

Query-DNA-Def dare_178|beg|356|length|104|forward|gi
Query_DNA-Sequence
accactacaaaagacaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattacccctgtgcatcccaatagaatcaacattaaacaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_182|beg|665|length|132|forward|gi
Query_DNA-Sequence
gtgttgacctctggtggtctagtgggtcgtatcactaagattgcTtgaagataacgcttacatcacaatcgagttgaacaccaacaacgaagttgtgatcaaaTgaaTggacttcgtgacctgcagtgctac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_183|beg|1624|length|146|forward|gi
Query_DNA-Sequence
gccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaatcaagt

Coding-DNA-Entry-Section

Coding-DNA
ccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaat
Protein-Sequence
PGVQDTARAKKILRARTRQPLNFREVDDKADPCRCGSQDVRLLAVEI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058067 to: 1058111
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058121 to: 1058153
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204887
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204801 to: 2204833
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940362
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073345 to: 1073383
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2540978 to: 2541016
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2489591 to: 2489629
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275315 to: 1275359

Coding-DNA
ccgggtgtacaagatacagcgcgtgctaaaaaaatTcttagggcgcgTacccgTcaacccttgaaTtttcgtgaagtggacgataaagccgacccttgccgctgcggcagTcaggacgtgcgcctgctggcagTcgaaat
Protein-Sequence
PGVQDTARAKKILRARTRQPLNFREVDDKADPCRCGSQDVRLLAVEI
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058067 to: 1058111
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1058121 to: 1058153
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204843 to: 2204887
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204801 to: 2204833
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940318 to: 940362
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073345 to: 1073383
gi-nr: gi|126240836 gi_def: Burkholderia mallei NCTC 10247 chromosome II, complete sequence hsp_num: 2 from: 2540978 to: 2541016
gi-nr: gi|52426793 gi_def: Burkholderia mallei ATCC 23344 chromosome 1, complete sequence hsp_num: 2 from: 2489591 to: 2489629
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275315 to: 1275359


Query-DNA-Entry-Section

Query-DNA-Def dare_184|beg|744|length|125|forward|gi
Query_DNA-Sequence
ccaacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctttaaaacagccataaggatcctcgctgtgctaaaccgttatccgttatggaagta

Coding-DNA-Entry-Section

Coding-DNA
caacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctt
Protein-Sequence
NNEVVIKKDFVTAVLPKGTLKSL
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754447 to: 754524
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440244 to: 440321
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616845 to: 616922
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057185 to: 1057262
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 286456 to: 286539
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129336 to: 129407
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205730 to: 2205801
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 579 to: 644
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274439 to: 1274507
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1632 to: 1697
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1633 to: 1698
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 997 to: 1062
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491185 to: 491250
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491183 to: 491248
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400289 to: 400360
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501745 to: 501810
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443526 to: 443591
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441937 to: 442002
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460429 to: 460494
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495044 to: 495109
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412648 to: 412713
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426778 to: 426843
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491346 to: 491411
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426778 to: 426843
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357052 to: 357117
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356187 to: 356252
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391151 to: 391216
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316525 to: 316590
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976961 to: 977032
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316290 to: 316355
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109293 to: 1109361
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7004 to: 7069
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554904 to: 2554972
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526592 to: 2526657
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506730 to: 506795
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438292 to: 3438363
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410744 to: 2410809
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847800 to: 2847865
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627703 to: 627771
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203443 to: 203508
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11612 to: 11677
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57847 to: 57912
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123250 to: 1123321
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513043 to: 3513114
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984551 to: 2984622
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552161 to: 3552232
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123538 to: 1123609
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803293 to: 803364
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050678 to: 1050749
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199116 to: 3199187
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245577 to: 245648
gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 1 from: 337 to: 402
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 140071 to: 140136

Coding-DNA
caacaacgaagttgtgatcaagaaggacttcgtgactgcagtgctaccaaaaggtacgctgaaatctctt
Protein-Sequence
NNEVVIKKDFVTAVLPKGTLKSL
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754447 to: 754524
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440244 to: 440321
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616845 to: 616922
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057185 to: 1057262
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 286456 to: 286539
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129336 to: 129407
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205730 to: 2205801
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 579 to: 644
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1274439 to: 1274507
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1632 to: 1697
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1633 to: 1698
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 997 to: 1062
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491185 to: 491250
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491183 to: 491248
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 400289 to: 400360
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501745 to: 501810
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443526 to: 443591
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441937 to: 442002
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 460429 to: 460494
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495044 to: 495109
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412648 to: 412713
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426778 to: 426843
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 491346 to: 491411
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426778 to: 426843
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357052 to: 357117
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356187 to: 356252
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391151 to: 391216
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316525 to: 316590
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976961 to: 977032
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316290 to: 316355
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1109293 to: 1109361
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7004 to: 7069
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554904 to: 2554972
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2526592 to: 2526657
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506730 to: 506795
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438292 to: 3438363
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2410744 to: 2410809
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2847800 to: 2847865
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627703 to: 627771
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 203443 to: 203508
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11612 to: 11677
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57847 to: 57912
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1123250 to: 1123321
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513043 to: 3513114
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2984551 to: 2984622
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552161 to: 3552232
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1123538 to: 1123609
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 803293 to: 803364
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050678 to: 1050749
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199116 to: 3199187
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245577 to: 245648
gi-nr: gi|109694066 gi_def: Synthetic construct Yersinia pestis clone FLH0121716.01X y0992 gene, complete sequence hsp_num: 1 from: 337 to: 402
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 140071 to: 140136


Query-DNA-Entry-Section

Query-DNA-Def dare_185|beg|2480|length|103|forward|gi
Query_DNA-Sequence
tacgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttcgcag

Coding-DNA-Entry-Section

Coding-DNA
acgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttc
Protein-Sequence
AKPLIAPVPTANKMIAVIKVVMLASAMVLNALA
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756186 to: 756284
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438484 to: 438582
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618584 to: 618682
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131076 to: 131174
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203932 to: 2204030
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612669 to: 1612764
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058924 to: 1059022
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684097 to: 1684192
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667441 to: 1667536
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 322 to: 420
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244294 to: 3244389
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881220 to: 2881315
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733143 to: 1733238
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694501 to: 2694596
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636946 to: 1637044

Coding-DNA
acgctaacgcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcgattaaaggcttc
Protein-Sequence
AKPLIAPVPTANKMIAVIKVVMLASAMVLNALA
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756186 to: 756284
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438484 to: 438582
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618584 to: 618682
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131076 to: 131174
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203932 to: 2204030
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612669 to: 1612764
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058924 to: 1059022
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684097 to: 1684192
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667441 to: 1667536
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 322 to: 420
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244294 to: 3244389
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881220 to: 2881315
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733143 to: 1733238
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694501 to: 2694596
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636946 to: 1637044


Query-DNA-Entry-Section

Query-DNA-Def dare_186|beg|524|length|118|forward|gi
Query_DNA-Sequence
gTccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaaaacctg

Coding-DNA-Entry-Section

Coding-DNA
TccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaa
Protein-Sequence
PHKVAVFEMIIMLAMFAVIFYFMIYRPQCLSVSKNTK
Hit-Information Section
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900797 to: 1900859
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205940 to: 2206002
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804420 to: 2804482
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234547 to: 1234609
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129135 to: 129197
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462652 to: 1462714

Coding-DNA
TccccacaaggtggcggTttttgaaatgatcatcatgctcgcgatgttcgcagtgatcttctatttcatgatctaccgtccacaaTgcTtaagcgtgtcaaagaacacaaa
Protein-Sequence
PHKVAVFEMIIMLAMFAVIFYFMIYRPQCLSVSKNTK
Hit-Information Section
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900797 to: 1900859
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205940 to: 2206002
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804420 to: 2804482
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1234547 to: 1234609
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129135 to: 129197
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1462652 to: 1462714


Query-DNA-Entry-Section

Query-DNA-Def dare_189|beg|1932|length|136|forward|gi
Query_DNA-Sequence
agctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaagtTcattctgaccaagcatgaagaagtgattaaccaagcgacgattcagtcggcattgggacgtaacttccgta

Coding-DNA-Entry-Section

Coding-DNA
gctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaa
Protein-Sequence
TLPSGERLPLSLYSANTVAIS
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287643 to: 287705
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 4 from: 1058375 to: 1058437
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 130527 to: 130589
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 2204517 to: 2204579

Coding-DNA
gctgatggcgacggtgtttgccgaatacaaagacagcggtaagcgctctcctgaaggtaaa
Protein-Sequence
TLPSGERLPLSLYSANTVAIS
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 6 from: 287643 to: 287705
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 4 from: 1058375 to: 1058437
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 130527 to: 130589
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 2204517 to: 2204579


Query-DNA-Entry-Section

Query-DNA-Def dare_190|beg|1517|length|113|forward|gi
Query_DNA-Sequence
tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccggg

Coding-DNA-Entry-Section

Coding-DNA
tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccg
Protein-Sequence
SPVEQNITILRNRVNELGVAEPLVQRQGATRIVVELP
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057965 to: 1058069
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439437 to: 439541
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755227 to: 755331
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617729
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130221
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204885 to: 2204989
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110067 to: 1110171
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57037 to: 57141
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170110 to: 1170214
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512239 to: 3512343
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198312 to: 3198416
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803403 to: 2803507
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437488 to: 3437592
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901772 to: 1901876
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551357 to: 3551461
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804064 to: 804168
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 679 to: 783
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983747 to: 2983851
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051449 to: 1051553
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124309 to: 1124413
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124021 to: 1124125
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987063 to: 987167
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972397 to: 972501
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846990 to: 2847094
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401059 to: 401163
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275213 to: 1275317
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267751 to: 1267855
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285111 to: 2285215
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554097 to: 2554201
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461200 to: 461304
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492117 to: 492221
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279451 to: 3279555
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977731 to: 977835
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444297 to: 444401
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391922 to: 392026
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495815 to: 495919
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055660 to: 1055764
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442708 to: 442812
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1412 to: 1516
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8290 to: 8394
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1520 to: 1624
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357823 to: 357927
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514109 to: 1514213
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427549 to: 427653
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427549 to: 427653
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12383 to: 12487
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502516 to: 502620
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1768 to: 1872
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356958 to: 357062
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204214 to: 204318
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491954 to: 492058
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409934 to: 2410038
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525782 to: 2525886
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507501 to: 507605
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491956 to: 492060
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7775 to: 7879
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315480 to: 315584
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317296 to: 317400
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413419 to: 413523
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388694 to: 1388798
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555318 to: 1555422
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990438 to: 2990542
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877814 to: 3877918
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729388 to: 2729492
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695454 to: 2695558
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218293 to: 5218397
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494559 to: 3494663
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362749 to: 3362853
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308465 to: 1308569
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882170 to: 2882274
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274753 to: 3274857
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732184 to: 1732288
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666482 to: 1666586
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248232 to: 1248336
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245244 to: 3245348
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683138 to: 1683242
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611710 to: 1611814
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278156 to: 4278260
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233708 to: 233812
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232433 to: 232537
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145489
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853413 to: 1853517
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650173 to: 2650271
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164577 to: 3164681
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240552 to: 3240656
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419936 to: 1420040
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172570 to: 2172674
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504442 to: 1504546
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635990 to: 1636094
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597530 to: 4597634
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940360 to: 940470
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301554 to: 301658
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40466 to: 40570
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371570 to: 3371674
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080816 to: 3080920
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628486 to: 628590
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2151 to: 2261
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59238 to: 59348
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44962 to: 45066
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463630 to: 1463734
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153909 to: 1154019
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377035 to: 3377139
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695083 to: 2695187
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332659 to: 332763
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354667 to: 354771
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714374 to: 714478
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621777 to: 1621881
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241254 to: 2241358
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218713 to: 2218817
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245220 to: 2245324
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12226 to: 12330
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6694 to: 6798
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217917 to: 1218021
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085125 to: 1085229
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073488

Coding-DNA
tcgcccgttgagcagaacatcactattttgcgtaaccgggtgaacgaactgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggtagagctgccg
Protein-Sequence
SPVEQNITILRNRVNELGVAEPLVQRQGATRIVVELP
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057965 to: 1058069
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439437 to: 439541
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755227 to: 755331
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617625 to: 617729
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130117 to: 130221
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204885 to: 2204989
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110067 to: 1110171
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 57037 to: 57141
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1170110 to: 1170214
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512239 to: 3512343
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198312 to: 3198416
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2803403 to: 2803507
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3437488 to: 3437592
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1901772 to: 1901876
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551357 to: 3551461
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804064 to: 804168
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 679 to: 783
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983747 to: 2983851
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051449 to: 1051553
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124309 to: 1124413
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124021 to: 1124125
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987063 to: 987167
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972397 to: 972501
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846990 to: 2847094
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401059 to: 401163
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275213 to: 1275317
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267751 to: 1267855
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2285111 to: 2285215
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2554097 to: 2554201
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 461200 to: 461304
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 492117 to: 492221
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279451 to: 3279555
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 977731 to: 977835
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 444297 to: 444401
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391922 to: 392026
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 495815 to: 495919
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055660 to: 1055764
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 442708 to: 442812
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1412 to: 1516
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2128 to: 2232
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8290 to: 8394
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1520 to: 1624
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357823 to: 357927
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514109 to: 1514213
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 427549 to: 427653
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 427549 to: 427653
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 12383 to: 12487
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 502516 to: 502620
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 1768 to: 1872
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 356958 to: 357062
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 204214 to: 204318
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 491954 to: 492058
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409934 to: 2410038
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2525782 to: 2525886
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 507501 to: 507605
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 679 to: 783
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 491956 to: 492060
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 7775 to: 7879
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 315480 to: 315584
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317296 to: 317400
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 413419 to: 413523
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388694 to: 1388798
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555318 to: 1555422
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2990438 to: 2990542
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877814 to: 3877918
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2729388 to: 2729492
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695454 to: 2695558
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218293 to: 5218397
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3494559 to: 3494663
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3362749 to: 3362853
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308465 to: 1308569
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2882170 to: 2882274
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3274753 to: 3274857
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1732184 to: 1732288
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1666482 to: 1666586
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248232 to: 1248336
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3245244 to: 3245348
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1683138 to: 1683242
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1611710 to: 1611814
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278156 to: 4278260
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 233708 to: 233812
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 232433 to: 232537
gi-nr: gi|71143482 gi_def: Colwellia psychrerythraea 34H, complete genome hsp_num: 1 from: 1145385 to: 1145489
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1853413 to: 1853517
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2650173 to: 2650271
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3164577 to: 3164681
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3240552 to: 3240656
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419936 to: 1420040
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172570 to: 2172674
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1504442 to: 1504546
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1635990 to: 1636094
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597530 to: 4597634
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 940360 to: 940470
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301554 to: 301658
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40466 to: 40570
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3371570 to: 3371674
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3080816 to: 3080920
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 628486 to: 628590
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 2151 to: 2261
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 1 from: 59238 to: 59348
gi-nr: gi|67906522 gi_def: Uncultured bacterium MedeBAC49C08 clone MedeBAC49C08, partial sequence hsp_num: 1 from: 44962 to: 45066
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1463630 to: 1463734
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153909 to: 1154019
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377035 to: 3377139
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2695083 to: 2695187
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 332659 to: 332763
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 354667 to: 354771
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 714374 to: 714478
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1621777 to: 1621881
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2241254 to: 2241358
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2218713 to: 2218817
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2245220 to: 2245324
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 12226 to: 12330
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 6694 to: 6798
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217917 to: 1218021
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1085125 to: 1085229
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1073411 to: 1073488


Query-DNA-Entry-Section

Query-DNA-Def dare_195|beg|1549|length|115|forward|gi
Query_DNA-Sequence
taaccTgggtgaacgaactTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaaa

Coding-DNA-Entry-Section

Coding-DNA
tTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaa
Protein-Sequence
NLGVAEPLVQRQGATRIVVRAAGVVQDTARAKE
Hit-Information Section
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 789
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 787 to: 813
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 1876 to: 1902
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 204322 to: 204348
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 7883 to: 7909
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 12491 to: 12517
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987105 to: 987173
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972439 to: 972507
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439431 to: 439499
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755337
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617735
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204879 to: 2204947
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877808 to: 3877876
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279445 to: 3279513
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055770
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1406 to: 1474
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8284 to: 8352
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1514 to: 1582
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514219
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130227
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388804
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555428
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 940330 to: 940356
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301664
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846984 to: 2847052
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267861
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218287 to: 5218355
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110177
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275323
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 59208 to: 59234
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 628594 to: 628620
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308575
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248342
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278150 to: 4278218
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420046
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2121 to: 2147
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512233 to: 3512301
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198306 to: 3198374
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695448 to: 2695516
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551351 to: 3551419
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804174
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392032
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983741 to: 2983809
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051559
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124419
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357933
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357068
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124131
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317406
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597524 to: 4597592
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968935 to: 969003
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887931 to: 887999
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172680
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40576

Coding-DNA
tTgggtgtggctgagcctctggttcaacgccaaggtgcgacacgtatcgtggTtagagctgccggggtTgtacaagatacagcgcgtgctaaagaa
Protein-Sequence
NLGVAEPLVQRQGATRIVVRAAGVVQDTARAKE
Hit-Information Section
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 721 to: 789
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 2 from: 787 to: 813
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 2 from: 787 to: 813
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 1876 to: 1902
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 204322 to: 204348
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 7883 to: 7909
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 12491 to: 12517
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 2 from: 987105 to: 987173
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 2 from: 972439 to: 972507
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439431 to: 439499
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755269 to: 755337
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617667 to: 617735
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204879 to: 2204947
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877808 to: 3877876
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3279445 to: 3279513
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1055702 to: 1055770
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1406 to: 1474
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 2122 to: 2190
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 8284 to: 8352
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 1514 to: 1582
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514151 to: 1514219
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130159 to: 130227
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1388736 to: 1388804
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1555360 to: 1555428
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 2 from: 940330 to: 940356
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 301596 to: 301664
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2846984 to: 2847052
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1267793 to: 1267861
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5218287 to: 5218355
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110109 to: 1110177
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1275255 to: 1275323
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 59208 to: 59234
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 628594 to: 628620
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1308507 to: 1308575
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1248274 to: 1248342
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4278150 to: 4278218
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1419978 to: 1420046
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 2 from: 2121 to: 2147
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3512233 to: 3512301
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3198306 to: 3198374
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2695448 to: 2695516
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3551351 to: 3551419
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 804106 to: 804174
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 391964 to: 392032
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2983741 to: 2983809
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1051491 to: 1051559
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1124351 to: 1124419
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 357865 to: 357933
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 357000 to: 357068
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124063 to: 1124131
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 317338 to: 317406
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4597524 to: 4597592
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968935 to: 969003
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887931 to: 887999
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2172612 to: 2172680
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 40508 to: 40576


Query-DNA-Entry-Section

Query-DNA-Def dare_198|beg|2195|length|106|forward|gi
Query_DNA-Sequence
gatatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggc

Coding-DNA-Entry-Section

Coding-DNA
atatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatg
Protein-Sequence
YGYFRPVFGVWLAVMLFTVLYYRKFGMIANIALM
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287938 to: 288006
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438768 to: 438836
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755932 to: 756000
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618330 to: 618398
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1479 to: 1547
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694853
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125481

Coding-DNA
atatgggtaTttcaggcctgtatttggggtatggtTggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatg
Protein-Sequence
YGYFRPVFGVWLAVMLFTVLYYRKFGMIANIALM
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287938 to: 288006
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438768 to: 438836
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755932 to: 756000
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618330 to: 618398
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1479 to: 1547
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694785 to: 2694853
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125413 to: 1125481


Query-DNA-Entry-Section

Query-DNA-Def dare_204|beg|1012|length|113|forward|gi
Query_DNA-Sequence
taaagcgcaactctcccaaaaatccattgctcttgaaatggctcaatccttgttcgtttcaatgTatacggatacgcaaatcagcgcccgagatatcatcagtgaagcgttag

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_206|beg|2460|length|137|forward|gi
Query_DNA-Sequence
agcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaattacggcgatcattttgtttgccgttggtacaggggcggaTttaaaggcttcgcagtgacgctgtctat

Coding-DNA-Entry-Section

Coding-DNA
gcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaa
Protein-Sequence
QAIHQGYANAFSTIADANITT*L
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 9 from: 1624 to: 1686
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 288172 to: 288234
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 797462 to: 797524
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 364
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131118
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058966
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756228
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618626
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438540 to: 438602
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203988 to: 2204050
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361917
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273921
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667418 to: 1667480
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684074 to: 1684136
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733120 to: 1733182
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612646 to: 1612708
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881338
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493727
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244412
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728556
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694619
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636926 to: 1636988
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649341
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171049 to: 1171111
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239720
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125022
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511342 to: 3511404
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982850 to: 2982912
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550460 to: 3550522
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125310
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805065
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052450
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197415 to: 3197477
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524885 to: 2524947
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508502
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409037 to: 2409099
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205215
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13384
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284217 to: 2284279
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629413 to: 629475
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694183 to: 2694242
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480876 to: 1480938
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420946
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994878 to: 3994937
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852513 to: 1852572

Coding-DNA
gcaagcgattcatcaaggttacgctaacgcattcagtaccattgccgatgccaacatcaccacttaa
Protein-Sequence
QAIHQGYANAFSTIADANITT*L
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 9 from: 1624 to: 1686
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 288172 to: 288234
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 797462 to: 797524
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 302 to: 364
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 131056 to: 131118
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058904 to: 1058966
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756166 to: 756228
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618564 to: 618626
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438540 to: 438602
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2203988 to: 2204050
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3361855 to: 3361917
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3273859 to: 3273921
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1667418 to: 1667480
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1684074 to: 1684136
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1733120 to: 1733182
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1612646 to: 1612708
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2881276 to: 2881338
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3493665 to: 3493727
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3244350 to: 3244412
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728494 to: 2728556
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694557 to: 2694619
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636926 to: 1636988
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2649279 to: 2649341
gi-nr: gi|109693603 gi_def: Synthetic construct Yersinia pestis clone FLH0149459.01X secD gene, complete sequence hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1171049 to: 1171111
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3239658 to: 3239720
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1124960 to: 1125022
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3511342 to: 3511404
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2982850 to: 2982912
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3550460 to: 3550522
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1125248 to: 1125310
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 805003 to: 805065
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1052388 to: 1052450
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3197415 to: 3197477
gi-nr: gi|5834381 gi_def: Citrobacter freundii general protein secretion pathway subunit SecD gene, complete cds hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|3983167 gi_def: Salmonella choleraesuis SecD (secD) gene, complete cds hsp_num: 1 from: 1618 to: 1680
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2524885 to: 2524947
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 508440 to: 508502
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2409037 to: 2409099
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 205153 to: 205215
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 13322 to: 13384
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284217 to: 2284279
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 629413 to: 629475
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694183 to: 2694242
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480876 to: 1480938
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420884 to: 1420946
gi-nr: gi|117607074 gi_def: Magnetococcus sp. MC-1, complete genome hsp_num: 1 from: 3994878 to: 3994937
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852513 to: 1852572


Query-DNA-Entry-Section

Query-DNA-Def dare_207|beg|2213|length|133|forward|gi
Query_DNA-Sequence
tgtatttggggtatggtggcggtaatgctgtttacggttctttactaTccgtaagtttggcatgattgctaacatcgcactaaatggcgaacctcgtgttgatcattggcgtaatgtcgatgatccgggcgca

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_209|beg|1047|length|108|forward|gi
Query_DNA-Sequence
aaaatggctcaatccttgttcgtttaatgatacgggatacgcaaatcagcgcccgagatatcTatcagtgaagcgTttaggtaaggataaaatcgtcgcgttaacctc

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_210|beg|2391|length|124|forward|gi
Query_DNA-Sequence
tggcgggtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaaatccgcagcaagcgattcatcaaggttaTcgctaacgcattcagtaccattgccgatgcc

Coding-DNA-Entry-Section

Coding-DNA
ggcgggtcgatgccaacgtactgattttcgagcgtattcgtgaagagctacgcgaaggaaaaaatccgcagcaagcgattcatcaaggttaTcgct
Protein-Sequence
WRVDANVLIFERIREELREGKNPQQAIHQGYR*R
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 4 from: 288106 to: 288192
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 4 from: 797396 to: 797482
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 4 from: 1558 to: 1644
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 4 from: 438582 to: 438668
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 3 from: 756100 to: 756186
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 236 to: 322
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204030 to: 2204116
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 3 from: 1058838 to: 1058924
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130990 to: 131076
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 618498 to: 618584
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480810 to: 1480896


Query-DNA-Entry-Section

Query-DNA-Def dare_211|beg|337|length|127|forward|gi
Query_DNA-Sequence
gtcgtaaccgcgaagtgccaccactacaaaaaagacaaagcctgatttcgtgcactgggttggattttgcgtggtaagccgTcTttgaattcacccctgtgcatcccaatagaaatcaacattaaac

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_218|beg|334|length|111|forward|gi
Query_DNA-Sequence
cgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcgtggtaagccgcttgaattcTacccctgtgcatcccaat

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_219|beg|296|length|105|forward|gi
Query_DNA-Sequence
tgaagaccgttttgaccaatttgtagccgagttctacgcgctcgtaaccgcgaagtTgccaccactacaaaaaagacaaagcctgatttcgtgcactgggttgga

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_220|beg|2335|length|132|forward|gi
Query_DNA-Sequence
cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgcagcaag

Coding-DNA-Entry-Section

Coding-DNA
cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgca
Protein-Sequence
PGATMTLPGIAGIVLTVGMAVDANVLIFERIRERATRRKKSA
Hit-Information Section
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 176 to: 274
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130930 to: 131028
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553498 to: 553608
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058778 to: 1058876
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756040 to: 756138
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618438 to: 618536
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438630 to: 438728
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204078 to: 2204176
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 960056 to: 960157
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694629 to: 2694745
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337734 to: 337832
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 1439093 to: 1439191
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284289 to: 2284405
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802596 to: 2802694
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804531 to: 1804632
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902585 to: 1902683
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 2889124 to: 2889225
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480750 to: 1480848
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452910 to: 453032
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996466 to: 1996561
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244440 to: 3244538
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165387 to: 3165482
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069422 to: 1069517
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13018 to: 13131
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62956 to: 63051
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869506 to: 1869601
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125275 to: 1125370
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462310 to: 462426
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3000797 to: 3000898
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649369 to: 2649467
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503632 to: 1503730
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384702 to: 384818
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153099 to: 1153197
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44727 to: 44822
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7486 to: 7599
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445720 to: 1445812
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694273 to: 2694365
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557422 to: 1557520
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922649 to: 1922744
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896503 to: 896598
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356845 to: 356940
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331849 to: 331947
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725263 to: 725361
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355482 to: 355580
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877001 to: 3877096
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 707 to: 802
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217477 to: 5217572
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540233 to: 1540328
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268736 to: 268834
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 4143485 to: 4143586
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3493755 to: 3493853
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3923096 to: 3923197
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3361945 to: 3362043
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309287 to: 1309382
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987882 to: 987977
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881366 to: 2881464
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728584 to: 2728682
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3810320 to: 3810421
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3273949 to: 3274047
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732994 to: 1733092
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667292 to: 1667390
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249054 to: 1249149
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683948 to: 1684046
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612520 to: 1612618
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277343 to: 4277438
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056479 to: 1056574
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333275 to: 1333370
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636800 to: 1636898
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 599 to: 694
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7477 to: 7572
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824754 to: 1824849
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514931 to: 1515026
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244335
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428796 to: 1428891
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724045 to: 5724140
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239748 to: 3239846
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973216 to: 973311
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78892 to: 79005
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389516 to: 1389611
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556140 to: 1556235
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072568 to: 1072660
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 832400 to: 832498
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217110 to: 1217205
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237423 to: 3237533
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620967 to: 1621059
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939547 to: 939639
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1085942 to: 1086040
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41282 to: 41395
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852603 to: 1852695
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268564 to: 1268656
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1156308 to: 1156406
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 834301 to: 834399
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420764 to: 1420856
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1124954 to: 1125052
gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 1 from: 1573 to: 1671
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240444 to: 2240536
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695342 to: 2695437
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084318 to: 1084413
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217903 to: 2217995
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244410 to: 2244502
gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 1 from: 1651 to: 1749
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 830645 to: 830743
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1125003 to: 1125101
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596738 to: 4596830
gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591894 to: 591995
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1341 to: 1439
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209272 to: 209373
gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282781 to: 1282882
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636748 to: 1636855
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549794 to: 549898
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883664
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045593 to: 1045706
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777346 to: 4777447
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709721 to: 1709813
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169208 to: 2169303
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920562 to: 1920657
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056492 to: 2056593
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401477 to: 401572
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492802 to: 1492897
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278638 to: 3278730
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534117 to: 1534212
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650961 to: 1651056
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841186 to: 1841281
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71984 to: 72079
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156360 to: 156455
gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144060 to: 144152
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208203 to: 1208298
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435409 to: 435504
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268936 to: 1269031
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377899 to: 3377994
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577159 to: 577254
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236340 to: 1236435
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043489 to: 1043584
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572028 to: 572123
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618782 to: 4618874
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224472 to: 4224564
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029103 to: 1029198
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3256968 to: 3257060
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026518 to: 1026613
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001426 to: 2001518
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013764 to: 3013856
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152867 to: 1152962
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745360 to: 745452
gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8408 to: 8500
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887344 to: 2887439
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939467 to: 1939559
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017504 to: 1017596
gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1204 to: 1296
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65030 to: 65122
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243403 to: 5243495
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989637 to: 2989729
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094509 to: 3094601
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115830 to: 3115922
gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1531 to: 1626
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905665 to: 905754
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924365 to: 1924460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734837 to: 734932
gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44773 to: 44868
gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190689 to: 190778
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131767 to: 2131859
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496618 to: 1496713
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994261 to: 1994356
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745852 to: 7745947
gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244251 to: 244346
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560684 to: 1560779
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941568 to: 941663
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401937 to: 2402032
gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660917 to: 661033
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183387 to: 183482
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598086 to: 1598181
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575527 to: 1575622
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629540 to: 1629635
gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331462 to: 331578
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401872 to: 401970
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978544 to: 978642
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13805 to: 13897
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081118 to: 1081213
gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107230 to: 2107325
gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438200 to: 2438295
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207049 to: 2207141
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10420 to: 10512
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834637 to: 1834732
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110880 to: 1110978
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869343 to: 2869438
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276026 to: 1276124
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56230 to: 56328
gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224726 to: 2224821
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122463 to: 122558
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1492 to: 1590
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 673351 to: 673446
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804327 to: 1804440
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476927 to: 1477022
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143860 to: 143955
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715193 to: 715285
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833411 to: 833500
gi-nr: gi|152933790 gi_def: Clostridium botulinum F str. Langeland, complete genome hsp_num: 1 from: 3290067 to: 3290159
gi-nr: gi|152930382 gi_def: Clostridium botulinum A str. Hall, complete genome hsp_num: 1 from: 3121081 to: 3121173
gi-nr: gi|152926829 gi_def: Clostridium botulinum A str. ATCC 19397, complete genome hsp_num: 1 from: 3223665 to: 3223757
gi-nr: gi|148287495 gi_def: Clostridium botulinum A str. ATCC 3502 complete genome hsp_num: 1 from: 3251325 to: 3251417
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 800234 to: 800323
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 801783 to: 801872
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 805035 to: 805124
gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358049 to: 1358141
gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048746 to: 1048838
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824113 to: 824202
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877817 to: 877906
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611208 to: 1611300
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 234524 to: 234619
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3049394 to: 3049489
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 233249 to: 233344
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415097 to: 2415189
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2611376 to: 2611471
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 1613 to: 1708
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 1452 to: 1547
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2102563 to: 2102658
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2631603 to: 2631698
gi-nr: gi|152206095 gi_def: Clostridium kluyveri DSM 555, complete genome hsp_num: 1 from: 3199512 to: 3199607
gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64740 to: 64835
gi-nr: gi|41821838 gi_def: Treponema denticola ATCC 35405, complete genome hsp_num: 1 from: 719219 to: 719308
gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4501 to: 4593
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395958 to: 396050
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241373 to: 1241465
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162569 to: 1162658
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 302325 to: 302417
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515261 to: 1515353
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63205 to: 63297
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176390 to: 176482
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45269 to: 45361
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301967 to: 302059
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533068 to: 533160
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3532129 to: 3532221
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 976493 to: 976585
gi-nr: gi|33236383 gi_def: Chlamydophila pneumoniae TW-183, section 3 of 4 of the complete genome hsp_num: 1 from: 47529 to: 47621
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 190103 to: 190195
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 190226 to: 190318
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 651390 to: 651482
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 650711 to: 650803
gi-nr: gi|25168256 gi_def: Clostridium acetobutylicum ATCC 824, complete genome hsp_num: 1 from: 2381304 to: 2381393
gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 189347 to: 189439
gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359104 to: 1359193
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887169 to: 887261
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 522884 to: 522976
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 873121 to: 873213
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2173347 to: 2173439
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 833087 to: 833179
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 520480 to: 520572
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3372341 to: 3372433
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3203518 to: 3203610
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3081587 to: 3081679
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1416746 to: 1416838
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765142 to: 2765234
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4984253 to: 4984342
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2922080 to: 2922172
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 525369 to: 525461
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 703619 to: 703711
gi-nr: gi|149901357 gi_def: Clostridium beijerinckii NCIMB 8052, complete genome hsp_num: 1 from: 1811231 to: 1811326
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1825474 to: 1825560
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968173 to: 968265
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 191437 to: 191529
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 747818 to: 747910
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 800850 to: 800942
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 251674 to: 251766
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4260840 to: 4260932
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5168922 to: 5169014

Coding-DNA
cccgggcgcaaccatgaccttgccgggtattgctggtatcgtgttgacggtcggtatggcggtcgatgccaacgtactgattttcgagcgtattcgtgaaagagctacgcgaaggaaaaaatccgca
Protein-Sequence
PGATMTLPGIAGIVLTVGMAVDANVLIFERIRERATRRKKSA
Hit-Information Section
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 1 from: 176 to: 274
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130930 to: 131028
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 553498 to: 553608
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058778 to: 1058876
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 756040 to: 756138
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618438 to: 618536
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438630 to: 438728
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204078 to: 2204176
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 960056 to: 960157
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2694629 to: 2694745
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 337734 to: 337832
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 3 from: 1439093 to: 1439191
gi-nr: gi|56178122 gi_def: Idiomarina loihiensis L2TR, complete genome hsp_num: 1 from: 2284289 to: 2284405
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2802596 to: 2802694
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 2 from: 1804531 to: 1804632
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1902585 to: 1902683
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 2 from: 2889124 to: 2889225
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1480750 to: 1480848
gi-nr: gi|145554299 gi_def: Rhodobacter sphaeroides ATCC 17025, complete genome hsp_num: 1 from: 452910 to: 453032
gi-nr: gi|114737225 gi_def: Hyphomonas neptunium ATCC 15444, complete genome hsp_num: 1 from: 1996466 to: 1996561
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 2 from: 3244440 to: 3244538
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3165387 to: 3165482
gi-nr: gi|99036121 gi_def: Silicibacter sp. TM1040, complete genome hsp_num: 1 from: 1069422 to: 1069517
gi-nr: gi|119713395 gi_def: Uncultured marine bacterium HF130_81H07 genomic sequence hsp_num: 1 from: 13018 to: 13131
gi-nr: gi|94730694 gi_def: Lawsonia intracellularis PHE/MN1-00 hsp_num: 1 from: 62956 to: 63051
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 1869506 to: 1869601
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 1125275 to: 1125370
gi-nr: gi|126102442 gi_def: Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence hsp_num: 1 from: 462310 to: 462426
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 3000797 to: 3000898
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 2 from: 2649369 to: 2649467
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1503632 to: 1503730
gi-nr: gi|77386383 gi_def: Rhodobacter sphaeroides 2.4.1 chromosome 1, complete sequence hsp_num: 1 from: 384702 to: 384818
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1153099 to: 1153197
gi-nr: gi|146232099 gi_def: Dichelobacter nodosus VCS1703A, complete genome hsp_num: 1 from: 44727 to: 44822
gi-nr: gi|119713211 gi_def: Uncultured marine bacterium HF10_05C07 genomic sequence hsp_num: 1 from: 7486 to: 7599
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1445720 to: 1445812
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2694273 to: 2694365
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1557422 to: 1557520
gi-nr: gi|110283346 gi_def: Mesorhizobium sp. BNC1, complete genome hsp_num: 1 from: 1922649 to: 1922744
gi-nr: gi|47118328 gi_def: Mesorhizobium loti MAFF303099 DNA, complete genome hsp_num: 1 from: 896503 to: 896598
gi-nr: gi|46399275 gi_def: Parachlamydia-related symbiont UWE25, complete genome hsp_num: 1 from: 356845 to: 356940
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 331849 to: 331947
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 725263 to: 725361
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 355482 to: 355580
gi-nr: gi|145573243 gi_def: Pseudomonas mendocina ymp, complete genome hsp_num: 1 from: 3877001 to: 3877096
gi-nr: gi|51102888 gi_def: Pseudomonas viridiflava strain RMX23.1a pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 707 to: 802
gi-nr: gi|77380231 gi_def: Pseudomonas fluorescens PfO-1, complete genome hsp_num: 1 from: 5217477 to: 5217572
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1540233 to: 1540328
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 268736 to: 268834
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 4143485 to: 4143586
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 2 from: 3493755 to: 3493853
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3923096 to: 3923197
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 2 from: 3361945 to: 3362043
gi-nr: gi|150958624 gi_def: Pseudomonas aeruginosa PA7, complete genome hsp_num: 1 from: 1309287 to: 1309382
gi-nr: gi|148509317 gi_def: Pseudomonas putida F1, complete genome hsp_num: 1 from: 987882 to: 987977
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 2 from: 2881366 to: 2881464
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2728584 to: 2728682
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3810320 to: 3810421
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 2 from: 3273949 to: 3274047
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 2 from: 1732994 to: 1733092
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 2 from: 1667292 to: 1667390
gi-nr: gi|115583796 gi_def: Pseudomonas aeruginosa UCBPP-PA14, complete genome hsp_num: 1 from: 1249054 to: 1249149
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 2 from: 1683948 to: 1684046
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 2 from: 1612520 to: 1612618
gi-nr: gi|110227054 gi_def: Pseudomonas aeruginosa PAO1, complete genome hsp_num: 1 from: 4277343 to: 4277438
gi-nr: gi|95101722 gi_def: Pseudomonas entomophila str. L48 chromosome,complete sequence hsp_num: 1 from: 1056479 to: 1056574
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 1333275 to: 1333370
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1636800 to: 1636898
gi-nr: gi|51103032 gi_def: Pseudomonas viridiflava strain PNA3.3a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 599 to: 694
gi-nr: gi|51102971 gi_def: Pseudomonas viridiflava strain LP23.1a pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410
gi-nr: gi|51102953 gi_def: Pseudomonas viridiflava strain RMX3.1b pathogenicity island PAI-Region-1, partial sequence hsp_num: 1 from: 1315 to: 1410
gi-nr: gi|51102908 gi_def: Pseudomonas viridiflava strain ME3.1b pathogenicity island PAI-Region-1, complete sequence hsp_num: 1 from: 7477 to: 7572
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1824754 to: 1824849
gi-nr: gi|71553748 gi_def: Pseudomonas syringae pv. phaseolicola 1448A, complete genome hsp_num: 1 from: 1514931 to: 1515026
gi-nr: gi|72393774 gi_def: Ehrlichia canis str. Jake, complete genome hsp_num: 1 from: 1244222 to: 1244335
gi-nr: gi|88597753 gi_def: Anaplasma phagocytophilum HZ, complete genome hsp_num: 1 from: 1428796 to: 1428891
gi-nr: gi|68342549 gi_def: Pseudomonas fluorescens Pf-5, complete genome hsp_num: 1 from: 5724045 to: 5724140
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 2 from: 3239748 to: 3239846
gi-nr: gi|24987239 gi_def: Pseudomonas putida KT2440 complete genome hsp_num: 1 from: 973216 to: 973311
gi-nr: gi|42410857 gi_def: Wolbachia endosymbiont of Drosophila melanogaster, complete genome hsp_num: 1 from: 78892 to: 79005
gi-nr: gi|63253978 gi_def: Pseudomonas syringae pv. syringae B728a, complete genome hsp_num: 1 from: 1389516 to: 1389611
gi-nr: gi|28856110 gi_def: Pseudomonas syringae pv. tomato str. DC3000, complete genome hsp_num: 1 from: 1556140 to: 1556235
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 1 from: 1072568 to: 1072660
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 832400 to: 832498
gi-nr: gi|154355007 gi_def: Coxiella burnetii Dugway 7E9-12, complete genome hsp_num: 1 from: 1217110 to: 1217205
gi-nr: gi|154154406 gi_def: Parvibaculum lavamentivorans DS-1, complete genome hsp_num: 1 from: 3237423 to: 3237533
gi-nr: gi|148279912 gi_def: Legionella pneumophila str. Corby, complete genome hsp_num: 1 from: 1620967 to: 1621059
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 939547 to: 939639
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1085942 to: 1086040
gi-nr: gi|119713573 gi_def: Uncultured marine bacterium EB0_39H12 genomic sequence hsp_num: 1 from: 41282 to: 41395
gi-nr: gi|121588215 gi_def: Halorhodospira halophila SL1, complete genome hsp_num: 1 from: 1852603 to: 1852695
gi-nr: gi|120322793 gi_def: Marinobacter aquaeolei VT8, complete genome hsp_num: 1 from: 1268564 to: 1268656
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1156308 to: 1156406
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 834301 to: 834399
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1420764 to: 1420856
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1124954 to: 1125052
gi-nr: gi|109698469 gi_def: Synthetic construct Francisella tularensis clone FLH156741.01X secD gene, complete sequence hsp_num: 1 from: 1573 to: 1671
gi-nr: gi|52627367 gi_def: Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete genome hsp_num: 1 from: 2240444 to: 2240536
gi-nr: gi|82943940 gi_def: Magnetospirillum magneticum AMB-1 DNA, complete genome hsp_num: 1 from: 2695342 to: 2695437
gi-nr: gi|71066702 gi_def: Coxiella burnetii RSA 493, complete genome hsp_num: 1 from: 1084318 to: 1084413
gi-nr: gi|53752796 gi_def: Legionella pneumophila str. Lens complete genome hsp_num: 1 from: 2217903 to: 2217995
gi-nr: gi|53749768 gi_def: Legionella pneumophila str. Paris complete genome hsp_num: 1 from: 2244410 to: 2244502
gi-nr: gi|62261534 gi_def: Synthetic construct isolate FTT1115 unknown protein gene, complete cds hsp_num: 1 from: 1651 to: 1749
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 830645 to: 830743
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1125003 to: 1125101
gi-nr: gi|83630956 gi_def: Hahella chejuensis KCTC 2396, complete genome hsp_num: 1 from: 4596738 to: 4596830
gi-nr: gi|156527546 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence hsp_num: 1 from: 591894 to: 591995
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 1341 to: 1439
gi-nr: gi|15074266 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 6/12 hsp_num: 1 from: 209272 to: 209373
gi-nr: gi|47118311 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2, complete sequence hsp_num: 1 from: 1282781 to: 1282882
gi-nr: gi|120561280 gi_def: Desulfovibrio vulgaris subsp. vulgaris DP4, complete genome hsp_num: 1 from: 1636748 to: 1636855
gi-nr: gi|88600124 gi_def: Neorickettsia sennetsu strain Miyayama, complete genome hsp_num: 1 from: 549794 to: 549898
gi-nr: gi|46451220 gi_def: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough, complete genome hsp_num: 1 from: 1883557 to: 1883664
gi-nr: gi|58418577 gi_def: Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome hsp_num: 1 from: 1045593 to: 1045706
gi-nr: gi|154158043 gi_def: Xanthobacter autotrophicus Py2, complete genome hsp_num: 1 from: 4777346 to: 4777447
gi-nr: gi|146739436 gi_def: Orientia tsutsugamushi Boryong complete genome hsp_num: 1 from: 1709721 to: 1709813
gi-nr: gi|115254414 gi_def: Rhizobium leguminosarum bv. viciae chromosome complete genome, strain 3841 hsp_num: 1 from: 2169208 to: 2169303
gi-nr: gi|86279771 gi_def: Rhizobium etli CFN 42, complete genome hsp_num: 1 from: 1920562 to: 1920657
gi-nr: gi|83574254 gi_def: Rhodospirillum rubrum ATCC 11170, complete genome hsp_num: 1 from: 2056492 to: 2056593
gi-nr: gi|151423458 gi_def: Sulfurovum sp. NBC37-1 genomic DNA, complete genome hsp_num: 1 from: 401477 to: 401572
gi-nr: gi|151421614 gi_def: Nitratiruptor sp. SB155-2 genomic DNA, complete genome hsp_num: 1 from: 1492802 to: 1492897
gi-nr: gi|145568602 gi_def: Pseudomonas stutzeri A1501, complete genome hsp_num: 1 from: 3278638 to: 3278730
gi-nr: gi|116696516 gi_def: Syntrophobacter fumaroxidans MPOB, complete genome hsp_num: 1 from: 1534117 to: 1534212
gi-nr: gi|78496741 gi_def: Thiomicrospira denitrificans ATCC 33889, complete genome hsp_num: 1 from: 1650961 to: 1651056
gi-nr: gi|86556045 gi_def: Synechococcus sp. JA-2-3B'a(2-13), complete genome hsp_num: 1 from: 1841186 to: 1841281
gi-nr: gi|86553275 gi_def: Synechococcus sp. JA-3-3Ab, complete genome hsp_num: 1 from: 71984 to: 72079
gi-nr: gi|34483186 gi_def: Wolinella succinogenes, complete genome; segment 4/7 hsp_num: 1 from: 156360 to: 156455
gi-nr: gi|3861033 gi_def: Rickettsia prowazekii strain Madrid E, complete genome; segment 3/4 hsp_num: 1 from: 144060 to: 144152
gi-nr: gi|157101370 gi_def: Campylobacter concisus 13826, complete genome hsp_num: 1 from: 1208203 to: 1208298
gi-nr: gi|153803875 gi_def: Campylobacter hominis ATCC BAA-381, complete genome hsp_num: 1 from: 435409 to: 435504
gi-nr: gi|153792987 gi_def: Campylobacter curvus 525.92, complete genome hsp_num: 1 from: 1268936 to: 1269031
gi-nr: gi|126385999 gi_def: Acinetobacter baumannii ATCC 17978, complete genome hsp_num: 1 from: 3377899 to: 3377994
gi-nr: gi|49529273 gi_def: Acinetobacter sp. ADP1 complete genome hsp_num: 1 from: 577159 to: 577254
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 1236340 to: 1236435
gi-nr: gi|157385286 gi_def: Campylobacter jejuni subsp. jejuni 81116, complete genome hsp_num: 1 from: 1043489 to: 1043584
gi-nr: gi|152938384 gi_def: Campylobacter jejuni subsp. doylei 269.97, complete genome hsp_num: 1 from: 572028 to: 572123
gi-nr: gi|146403799 gi_def: Bradyrhizobium sp. BTAi1, complete genome hsp_num: 1 from: 4618782 to: 4618874
gi-nr: gi|146189981 gi_def: Bradyrhizobium sp. ORS278,complete sequence hsp_num: 1 from: 4224472 to: 4224564
gi-nr: gi|121504137 gi_def: Campylobacter jejuni subsp. jejuni 81-176, complete genome hsp_num: 1 from: 1029103 to: 1029198
gi-nr: gi|115515977 gi_def: Rhodopseudomonas palustris BisA53, complete genome hsp_num: 1 from: 3256968 to: 3257060
gi-nr: gi|30407139 gi_def: Campylobacter jejuni subsp. jejuni NCTC 11168 complete genome hsp_num: 1 from: 1026518 to: 1026613
gi-nr: gi|91798527 gi_def: Nitrobacter hamburgensis X14, complete genome hsp_num: 1 from: 2001426 to: 2001518
gi-nr: gi|90103542 gi_def: Rhodopseudomonas palustris BisB18, complete genome hsp_num: 1 from: 3013764 to: 3013856
gi-nr: gi|57165696 gi_def: Campylobacter jejuni RM1221, complete genome hsp_num: 1 from: 1152867 to: 1152962
gi-nr: gi|51459527 gi_def: Rickettsia typhi str. Wilmington complete genome hsp_num: 1 from: 745360 to: 745452
gi-nr: gi|15619990 gi_def: Rickettsia conorii str. Malish 7, section 75 of 114 of the complete genome hsp_num: 1 from: 8408 to: 8500
gi-nr: gi|39985517 gi_def: Geobacter sulfurreducens PCA, complete genome hsp_num: 1 from: 2887344 to: 2887439
gi-nr: gi|74419069 gi_def: Nitrobacter winogradskyi Nb-255, complete genome hsp_num: 1 from: 1939467 to: 1939559
gi-nr: gi|67003925 gi_def: Rickettsia felis URRWXCal2, complete genome hsp_num: 1 from: 1017504 to: 1017596
gi-nr: gi|19110413 gi_def: Rickettsia typhi export membrane protein SecD gene, complete cds hsp_num: 1 from: 1204 to: 1296
gi-nr: gi|39649689 gi_def: Rhodopseudomonas palustris CGA009 complete genome; segment 10/16 hsp_num: 1 from: 65030 to: 65122
gi-nr: gi|47118316 gi_def: Bradyrhizobium japonicum USDA 110 DNA, complete genome hsp_num: 1 from: 5243403 to: 5243495
gi-nr: gi|150834967 gi_def: Marinomonas sp. MWYL1, complete genome hsp_num: 1 from: 2989637 to: 2989729
gi-nr: gi|91680938 gi_def: Rhodopseudomonas palustris BisB5, complete genome hsp_num: 1 from: 3094509 to: 3094601
gi-nr: gi|86570155 gi_def: Rhodopseudomonas palustris HaA2, complete genome hsp_num: 1 from: 3115830 to: 3115922
gi-nr: gi|2252771 gi_def: Rhodobacter capsulatus YajC (yajC) gene, partial cds, and SecD (secD) and SecF (secF) genes, complete cds hsp_num: 1 from: 1531 to: 1626
gi-nr: gi|123199600 gi_def: Prochlorococcus marinus str. MIT 9515, complete genome hsp_num: 1 from: 905665 to: 905754
gi-nr: gi|118501159 gi_def: Pelobacter propionicus DSM 2379, complete genome hsp_num: 1 from: 1924365 to: 1924460
gi-nr: gi|118413283 gi_def: Campylobacter fetus subsp. fetus 82-40, complete genome hsp_num: 1 from: 734837 to: 734932
gi-nr: gi|39575856 gi_def: Bdellovibrio bacteriovorus complete genome, strain HD100; segment 7/11 hsp_num: 1 from: 44773 to: 44868
gi-nr: gi|33633869 gi_def: Prochlorococcus marinus MED4 complete genome; segment 3/5 hsp_num: 1 from: 190689 to: 190778
gi-nr: gi|21672293 gi_def: Chlorobium tepidum TLS, complete genome hsp_num: 1 from: 2131767 to: 2131859
gi-nr: gi|152026452 gi_def: Anaeromyxobacter sp. Fw109-5, complete genome hsp_num: 1 from: 1496618 to: 1496713
gi-nr: gi|146395585 gi_def: Geobacter uraniumreducens Rf4, complete genome hsp_num: 1 from: 1994261 to: 1994356
gi-nr: gi|110164990 gi_def: Trichodesmium erythraeum IMS101, complete genome hsp_num: 1 from: 7745852 to: 7745947
gi-nr: gi|109713861 gi_def: Helicobacter acinonychis str. Sheeba complete genome, strain Sheeba hsp_num: 1 from: 244251 to: 244346
gi-nr: gi|107836197 gi_def: Helicobacter pylori HPAG1, complete genome hsp_num: 1 from: 1560684 to: 1560779
gi-nr: gi|78192483 gi_def: Geobacter metallireducens GS-15, complete genome hsp_num: 1 from: 941568 to: 941663
gi-nr: gi|47118304 gi_def: Synechocystis sp. PCC 6803 DNA, complete genome hsp_num: 1 from: 2401937 to: 2402032
gi-nr: gi|55771382 gi_def: Thermus thermophilus HB8 genomic DNA, complete genome hsp_num: 1 from: 660917 to: 661033
gi-nr: gi|47118315 gi_def: Thermosynechococcus elongatus BP-1 DNA, complete genome hsp_num: 1 from: 183387 to: 183482
gi-nr: gi|12057207 gi_def: Helicobacter pylori J99, complete genome hsp_num: 1 from: 1598086 to: 1598181
gi-nr: gi|32263428 gi_def: Helicobacter hepaticus ATCC 51449, complete genome hsp_num: 1 from: 1575527 to: 1575622
gi-nr: gi|6626253 gi_def: Helicobacter pylori 26695, complete genome hsp_num: 1 from: 1629540 to: 1629635
gi-nr: gi|46197919 gi_def: Thermus thermophilus HB27, complete genome hsp_num: 1 from: 331462 to: 331578
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 401872 to: 401970
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 978544 to: 978642
gi-nr: gi|145204986 gi_def: Prosthecochloris vibrioformis DSM 265, complete genome hsp_num: 1 from: 13805 to: 13897
gi-nr: gi|125712750 gi_def: Clostridium thermocellum ATCC 27405, complete genome hsp_num: 1 from: 1081118 to: 1081213
gi-nr: gi|110681940 gi_def: Clostridium perfringens SM101, complete genome hsp_num: 1 from: 2107230 to: 2107325
gi-nr: gi|110673209 gi_def: Clostridium perfringens ATCC 13124, complete genome hsp_num: 1 from: 2438200 to: 2438295
gi-nr: gi|90823168 gi_def: Pelobacter carbinolicus DSM 2380, complete genome hsp_num: 1 from: 2207049 to: 2207141
gi-nr: gi|78165794 gi_def: Pelodictyon luteolum DSM 273, complete genome hsp_num: 1 from: 10420 to: 10512
gi-nr: gi|75699950 gi_def: Anabaena variabilis ATCC 29413, complete genome hsp_num: 1 from: 1834637 to: 1834732
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1110880 to: 1110978
gi-nr: gi|85772941 gi_def: Anaeromyxobacter dehalogenans 2CP-C, complete genome hsp_num: 1 from: 2869343 to: 2869438
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1276026 to: 1276124
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 56230 to: 56328
gi-nr: gi|47118322 gi_def: Clostridium perfringens str. 13 DNA, complete genome hsp_num: 1 from: 2224726 to: 2224821
gi-nr: gi|47118302 gi_def: Nostoc sp. PCC 7120 DNA, complete genome hsp_num: 1 from: 122463 to: 122558
gi-nr: gi|5524705 gi_def: Enterobacter aerogenes SecD protein (secD) gene, complete cds hsp_num: 1 from: 1492 to: 1590
gi-nr: gi|6626248 gi_def: Aquifex aeolicus VF5, complete genome hsp_num: 1 from: 673351 to: 673446
gi-nr: gi|98975575 gi_def: Sphingopyxis alaskensis RB2256, complete genome hsp_num: 1 from: 1804327 to: 1804440
gi-nr: gi|56684969 gi_def: Synechococcus elongatus PCC 6301 DNA, complete genome hsp_num: 1 from: 1476927 to: 1477022
gi-nr: gi|81167692 gi_def: Synechococcus elongatus PCC 7942, complete genome hsp_num: 1 from: 143860 to: 143955
gi-nr: gi|66270661 gi_def: Methylococcus capsulatus str. Bath, complete genome hsp_num: 1 from: 715193 to: 715285
gi-nr: gi|157386913 gi_def: Prochlorococcus marinus str. MIT 9215, complete genome hsp_num: 1 from: 833411 to: 833500
gi-nr: gi|152933790 gi_def: Clostridium botulinum F str. Langeland, complete genome hsp_num: 1 from: 3290067 to: 3290159
gi-nr: gi|152930382 gi_def: Clostridium botulinum A str. Hall, complete genome hsp_num: 1 from: 3121081 to: 3121173
gi-nr: gi|152926829 gi_def: Clostridium botulinum A str. ATCC 19397, complete genome hsp_num: 1 from: 3223665 to: 3223757
gi-nr: gi|148287495 gi_def: Clostridium botulinum A str. ATCC 3502 complete genome hsp_num: 1 from: 3251325 to: 3251417
gi-nr: gi|126542380 gi_def: Prochlorococcus marinus str. MIT 9301, complete genome hsp_num: 1 from: 800234 to: 800323
gi-nr: gi|123197646 gi_def: Prochlorococcus marinus str. AS9601, complete genome hsp_num: 1 from: 801783 to: 801872
gi-nr: gi|78711884 gi_def: Prochlorococcus marinus str. MIT 9312, complete genome hsp_num: 1 from: 805035 to: 805124
gi-nr: gi|20095250 gi_def: Fusobacterium nucleatum subsp. nucleatum ATCC 25586, complete genome hsp_num: 1 from: 1358049 to: 1358141
gi-nr: gi|118133308 gi_def: Clostridium novyi NT, complete genome hsp_num: 1 from: 1048746 to: 1048838
gi-nr: gi|154949252 gi_def: Prochlorococcus marinus str. NATL2A, complete genome hsp_num: 1 from: 824113 to: 824202
gi-nr: gi|123959780 gi_def: Prochlorococcus marinus str. NATL1A, complete genome hsp_num: 1 from: 877817 to: 877906
gi-nr: gi|114314838 gi_def: Granulibacter bethesdensis CGDNIH1, complete genome hsp_num: 1 from: 1611208 to: 1611300
gi-nr: gi|12057211 gi_def: Xylella fastidiosa 9a5c, complete genome hsp_num: 1 from: 234524 to: 234619
gi-nr: gi|78033986 gi_def: Xanthomonas campestris pv. vesicatoria complete genome hsp_num: 1 from: 3049394 to: 3049489
gi-nr: gi|28058986 gi_def: Xylella fastidiosa Temecula1, complete genome hsp_num: 1 from: 233249 to: 233344
gi-nr: gi|149947715 gi_def: Alkaliphilus metalliredigens QYMF, complete genome hsp_num: 1 from: 2415097 to: 2415189
gi-nr: gi|84365597 gi_def: Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome hsp_num: 1 from: 2611376 to: 2611471
gi-nr: gi|21108775 gi_def: Xanthomonas axonopodis pv. citri str. 306, section 268 of 469 of the complete genome hsp_num: 1 from: 1613 to: 1708
gi-nr: gi|21113525 gi_def: Xanthomonas campestris pv. campestris str. ATCC 33913, section 255 of 460 of the complete genome hsp_num: 1 from: 1452 to: 1547
gi-nr: gi|66571684 gi_def: Xanthomonas campestris pv. campestris str. 8004, complete genome hsp_num: 1 from: 2102563 to: 2102658
gi-nr: gi|58424217 gi_def: Xanthomonas oryzae pv. oryzae KACC10331, complete genome hsp_num: 1 from: 2631603 to: 2631698
gi-nr: gi|152206095 gi_def: Clostridium kluyveri DSM 555, complete genome hsp_num: 1 from: 3199512 to: 3199607
gi-nr: gi|15073438 gi_def: Sinorhizobium meliloti 1021 complete chromosome; segment 3/12 hsp_num: 1 from: 64740 to: 64835
gi-nr: gi|41821838 gi_def: Treponema denticola ATCC 35405, complete genome hsp_num: 1 from: 719219 to: 719308
gi-nr: gi|4996611 gi_def: Prevotella ruminicola genes for polygalacturonase, xylosidase, protein-export membrane protein, complete cds hsp_num: 1 from: 4501 to: 4593
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 395958 to: 396050
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1241373 to: 1241465
gi-nr: gi|147849409 gi_def: Synechococcus sp. RCC307 genomic DNA sequence hsp_num: 1 from: 1162569 to: 1162658
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 1 from: 302325 to: 302417
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1515261 to: 1515353
gi-nr: gi|33567884 gi_def: Bordetella bronchiseptica strain RB50, complete genome; segment 5/16 hsp_num: 1 from: 63205 to: 63297
gi-nr: gi|33565729 gi_def: Bordetella parapertussis strain 12822, complete genome; segment 4/14 hsp_num: 1 from: 176390 to: 176482
gi-nr: gi|33571793 gi_def: Bordetella pertussis strain Tohama I, complete genome; segment 4/12 hsp_num: 1 from: 45269 to: 45361
gi-nr: gi|124257968 gi_def: Methylibium petroleiphilum PM1, complete genome hsp_num: 1 from: 301967 to: 302059
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 533068 to: 533160
gi-nr: gi|71845263 gi_def: Dechloromonas aromatica RCB, complete genome hsp_num: 1 from: 3532129 to: 3532221
gi-nr: gi|89331179 gi_def: Chlamydophila felis Fe/C-56 DNA, complete genome hsp_num: 1 from: 976493 to: 976585
gi-nr: gi|33236383 gi_def: Chlamydophila pneumoniae TW-183, section 3 of 4 of the complete genome hsp_num: 1 from: 47529 to: 47621
gi-nr: gi|12057210 gi_def: Chlamydophila pneumoniae AR39, complete genome hsp_num: 1 from: 190103 to: 190195
gi-nr: gi|62147714 gi_def: Chlamydophila abortus strain S26/3, complete genome hsp_num: 1 from: 190226 to: 190318
gi-nr: gi|6626250 gi_def: Chlamydophila pneumoniae CWL029, complete genome hsp_num: 1 from: 651390 to: 651482
gi-nr: gi|47118320 gi_def: Chlamydophila pneumoniae J138 genomic DNA, complete sequence hsp_num: 1 from: 650711 to: 650803
gi-nr: gi|25168256 gi_def: Clostridium acetobutylicum ATCC 824, complete genome hsp_num: 1 from: 2381304 to: 2381393
gi-nr: gi|29835126 gi_def: Chlamydophila caviae GPIC, complete genome hsp_num: 1 from: 189347 to: 189439
gi-nr: gi|145408661 gi_def: Caldicellulosiruptor saccharolyticus DSM 8903, complete genome hsp_num: 1 from: 1359104 to: 1359193
gi-nr: gi|115421100 gi_def: Bordetella avium 197N complete genome hsp_num: 1 from: 887169 to: 887261
gi-nr: gi|76167241 gi_def: Chlamydia trachomatis A/HAR-13, complete genome hsp_num: 1 from: 522884 to: 522976
gi-nr: gi|29251571 gi_def: Chlamydia muridarum Nigg, complete genome hsp_num: 1 from: 873121 to: 873213
gi-nr: gi|74055513 gi_def: Thiobacillus denitrificans ATCC 25259, complete genome hsp_num: 1 from: 2173347 to: 2173439
gi-nr: gi|56311475 gi_def: Azoarcus sp. EbN1 complete genome hsp_num: 1 from: 833087 to: 833179
gi-nr: gi|12057206 gi_def: Chlamydia trachomatis D/UW-3/CX, complete genome hsp_num: 1 from: 520480 to: 520572
gi-nr: gi|113524807 gi_def: Ralstonia eutropha H16 chromosome 1 hsp_num: 1 from: 3372341 to: 3372433
gi-nr: gi|93352797 gi_def: Ralstonia metallidurans CH34, complete genome hsp_num: 1 from: 3203518 to: 3203610
gi-nr: gi|72117119 gi_def: Ralstonia eutropha JMP134 chromosome 1, complete sequence hsp_num: 1 from: 3081587 to: 3081679
gi-nr: gi|34105712 gi_def: Chromobacterium violaceum ATCC 12472, complete genome hsp_num: 1 from: 1416746 to: 1416838
gi-nr: gi|82409200 gi_def: Nitrosospira multiformis ATCC 25196, complete genome hsp_num: 1 from: 2765142 to: 2765234
gi-nr: gi|148566298 gi_def: Roseiflexus sp. RS-1, complete genome hsp_num: 1 from: 4984253 to: 4984342
gi-nr: gi|30407127 gi_def: Ralstonia solanacearum GMI1000 chromosome complete sequence hsp_num: 1 from: 2922080 to: 2922172
gi-nr: gi|91685338 gi_def: Burkholderia xenovorans LB400 chromosome 1, complete sequence hsp_num: 1 from: 525369 to: 525461
gi-nr: gi|77965403 gi_def: Burkholderia sp. 383 chromosome 1, complete sequence hsp_num: 1 from: 703619 to: 703711
gi-nr: gi|149901357 gi_def: Clostridium beijerinckii NCIMB 8052, complete genome hsp_num: 1 from: 1811231 to: 1811326
gi-nr: gi|134050581 gi_def: Desulfotomaculum reducens MI-1, complete genome hsp_num: 1 from: 1825474 to: 1825560
gi-nr: gi|119668705 gi_def: Azoarcus sp. BH72, complete genome hsp_num: 1 from: 968173 to: 968265
gi-nr: gi|59717368 gi_def: Neisseria gonorrhoeae FA 1090, complete genome hsp_num: 1 from: 191437 to: 191529
gi-nr: gi|134137285 gi_def: Burkholderia vietnamiensis G4 chromosome 1, complete genome hsp_num: 1 from: 747818 to: 747910
gi-nr: gi|116646113 gi_def: Burkholderia cenocepacia HI2424 chromosome 1, complete genome hsp_num: 1 from: 800850 to: 800942
gi-nr: gi|105891751 gi_def: Burkholderia cenocepacia AU 1054 chromosome 1, complete sequence hsp_num: 1 from: 251674 to: 251766
gi-nr: gi|120604516 gi_def: Acidovorax sp. JS42, complete genome hsp_num: 1 from: 4260840 to: 4260932
gi-nr: gi|120587178 gi_def: Acidovorax avenae subsp. citrulli AAC00-1, complete genome hsp_num: 1 from: 5168922 to: 5169014


Query-DNA-Entry-Section

Query-DNA-Def dare_223|beg|165|length|139|forward|gi
Query_DNA-Sequence
tgcaaaaattattcgaagtcatacctgcatcatctggatcctgtaacgaaatcctcggtgcacgcttgaatTactatccataaccctgcgttactaccaacgcttgatggaaagcattcgtaaagcgattgatgaagac

Coding-DNA-Entry-Section

Coding-DNA
aatcctcggtgcacgcttgaatTactatccataaccctgcgttactaccaacgcttgatggaaagcattcgtaaagcgattgatgaagac
Protein-Sequence
RNPRCTLELLSITLRYYQRLMESIRKAIDED
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753943 to: 753996
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440772 to: 440825
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616296 to: 616349
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056621 to: 1056674
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 2 from: 164 to: 214
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1217 to: 1267
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1218 to: 1268
gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 133 to: 186
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 2 from: 582 to: 632
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490770 to: 490820
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490768 to: 490818
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 2 from: 399874 to: 399924
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501330 to: 501380
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 443111 to: 443161
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441522 to: 441572
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 460014 to: 460064
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494629 to: 494679
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412233 to: 412283
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 2 from: 2527022 to: 2527072
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 2 from: 506315 to: 506365
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426363 to: 426413
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490931 to: 490981
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426363 to: 426413
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356637 to: 356687
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355772 to: 355822
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 2 from: 2411174 to: 2411224
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390736 to: 390786
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 316110 to: 316160
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316720 to: 316770
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108882 to: 1108932
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 2 from: 203028 to: 203078
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6589 to: 6639
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 2 from: 11197 to: 11247
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 2 from: 58340 to: 58390
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128922 to: 128975
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156617 to: 1156670
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 2 from: 2848229 to: 2848279
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831666 to: 831719
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334794 to: 334847
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728208 to: 728261
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271681 to: 271734
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352583 to: 352636
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117310 to: 1117363
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554506 to: 1554559
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976546 to: 976596
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3643 to: 3696
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 2 from: 335718 to: 335762
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 2 from: 267544 to: 267588
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627307 to: 627354
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 2 from: 1006 to: 1056
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 2 from: 1084 to: 1134
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 2 from: 1091074 to: 1091124
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 2 from: 825560 to: 825610
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 2 from: 829216 to: 829266
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 2 from: 1130134 to: 1130184
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 2 from: 1130085 to: 1130135
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 2 from: 827315 to: 827365
gi-nr: gi|148570901 gi_def: Psychrobacter sp. PRwf-1, complete genome hsp_num: 1 from: 2393442 to: 2393495
gi-nr: gi|92392509 gi_def: Psychrobacter cryohalolentis K5, complete genome hsp_num: 1 from: 2108592 to: 2108645
gi-nr: gi|71037566 gi_def: Psychrobacter arcticus 273-4, complete genome hsp_num: 1 from: 1864464 to: 1864517
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245127 to: 245171
gi-nr: gi|88599018 gi_def: Ehrlichia chaffeensis str. Arkansas, complete genome hsp_num: 2 from: 422574 to: 422612


Query-DNA-Entry-Section

Query-DNA-Def dare_224|beg|2489|length|134|forward|gi
Query_DNA-Sequence
gcattcagtaccattgccgatgccaacatcaccaccttaattacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtctTatcggtattttaacctctatTgtttac

Coding-DNA-Entry-Section

Coding-DNA
tacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtct
Protein-Sequence
LRRSFCLPLVQGLIKGFAVTLS
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 131155 to: 131187
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 4 from: 401 to: 433
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58269 to: 58301
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 2 from: 1072409 to: 1072441
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2447786 to: 2447839

Coding-DNA
tacggcgatcattttgtttgccgttggtacaggggcTgattaaaggcttcgcagtgacgctgtct
Protein-Sequence
LRRSFCLPLVQGLIKGFAVTLS
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 4 from: 131155 to: 131187
gi-nr: gi|57635381 gi_def: Photobacterium damselae subsp. piscicida partial secD gene for putative export protein and partial secF gene for putative preprotein translocase subunit, clone pRDA25 hsp_num: 4 from: 401 to: 433
gi-nr: gi|41582250 gi_def: Uncultured bacterium 578 clone EBAC080-L31E09 genomic sequence hsp_num: 2 from: 58269 to: 58301
gi-nr: gi|118566999 gi_def: Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete genome hsp_num: 2 from: 1072409 to: 1072441
gi-nr: gi|78217452 gi_def: Desulfovibrio desulfuricans G20, complete genome hsp_num: 1 from: 2447786 to: 2447839


Query-DNA-Entry-Section

Query-DNA-Def dare_225|beg|1398|length|115|forward|gi
Query_DNA-Sequence
aaaactaagctgcttctggagtcgaaacaTccgtgatatgacctttacgacttcagaatccgaTtggccgttttgtgctcgtggctaagtttaccgaagctTcgcttacaggaaa

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_226|beg|1396|length|108|forward|gi
Query_DNA-Sequence
gcaaactaagctgcttTctggagtcgaaacaccgtTgatatTgacctttacgacttcTagaatccgatggccgttttgtctcgtggctaagtttaccgaagctcgctt

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_228|beg|145|length|127|forward|gi
Query_DNA-Sequence
ctcattgcTgactgttacacttgcaaaaattattcgaagtcatcctgcatcatctggatcgcctgtaacgaaaatcctcggtgcacgcttgaatcttatccataacctgcgttactaccaacgcttg

Coding-DNA-Entry-Section

Coding-DNA
tcattgcTgactgttacacttgcaaaaattattcgaagtcatcctgcatcatctggatcgcctgtaacgaaaatcctcggtgcacgcttgaatcttatccataacctgcgttactaccaacgcttg
Protein-Sequence
SLLTVTLAKIIRSHPASSGSPVTKILGARLNLIHNLRYYQRL
Hit-Information Section
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753907 to: 753963
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440805 to: 440861
gi-nr: gi|545172 gi_def: Escherichia coli Tgt (tgt) gene, partial cds; YajC (yajC) gene, complete cds; and SecD (secD) gene, partial cds hsp_num: 1 from: 128 to: 184
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 616260 to: 616316
gi-nr: gi|48243689 gi_def: Haemophilus influenzae clone L002_HI_0197_N01 putative restriction/modification system protein gene, partial cds hsp_num: 1 from: 97 to: 153
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 1 from: 1181 to: 1237
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 1 from: 1182 to: 1238
gi-nr: gi|109698613 gi_def: Pseudoalteromonas atlantica T6c, complete genome hsp_num: 1 from: 1478663 to: 1478719
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206265 to: 2206321
gi-nr: gi|157315515 gi_def: Shewanella sediminis HAW-EB3, complete genome hsp_num: 1 from: 3495838 to: 3495894
gi-nr: gi|117558854 gi_def: Aeromonas hydrophila subsp. hydrophila ATCC 7966, complete genome hsp_num: 1 from: 1900513 to: 1900569
gi-nr: gi|142849896 gi_def: Aeromonas salmonicida subsp. salmonicida A449, complete genome hsp_num: 1 from: 2804711 to: 2804767
gi-nr: gi|42929 gi_def: Escherichia coli secD and secF genes for membrane proteins involved in protein export hsp_num: 1 from: 546 to: 602
gi-nr: gi|109694069 gi_def: Synthetic construct Yersinia pestis clone FLH0121712.01X tgt gene, complete sequence hsp_num: 1 from: 967 to: 1023
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 1 from: 490734 to: 490790
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 1 from: 490732 to: 490788
gi-nr: gi|150953431 gi_def: Klebsiella pneumoniae subsp. pneumoniae MGH 78578, complete sequence hsp_num: 1 from: 399838 to: 399894
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 1 from: 501294 to: 501350
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 1 from: 443075 to: 443131
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 1 from: 441486 to: 441542
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 1 from: 1273886 to: 1273942
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 1 from: 459978 to: 460034
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 1 from: 494593 to: 494649
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 1 from: 412197 to: 412253
gi-nr: gi|29140506 gi_def: Salmonella enterica subsp. enterica serovar Typhi Ty2, complete genome hsp_num: 1 from: 2527052 to: 2527108
gi-nr: gi|62126203 gi_def: Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67, complete genome hsp_num: 1 from: 506279 to: 506335
gi-nr: gi|157081501 gi_def: Citrobacter koseri ATCC BAA-895, complete genome hsp_num: 1 from: 2555367 to: 2555423
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 1 from: 426327 to: 426383
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 1 from: 490895 to: 490951
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 1 from: 426327 to: 426383
gi-nr: gi|122087364 gi_def: Yersinia enterocolitica subsp. enterocolitica 8081 complete genome hsp_num: 1 from: 3438857 to: 3438913
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 1 from: 356601 to: 356657
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 1 from: 355736 to: 355792
gi-nr: gi|56126533 gi_def: Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 hsp_num: 1 from: 2411204 to: 2411260
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 1 from: 390700 to: 390756
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 1 from: 316074 to: 316130
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 1 from: 316750 to: 316806
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 1 from: 1108846 to: 1108902
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1056585 to: 1056641
gi-nr: gi|36787140 gi_def: Photorhabdus luminescens subsp. laumondii TTO1 complete genome; segment 14/17 hsp_num: 1 from: 58370 to: 58426
gi-nr: gi|16501496 gi_def: Salmonella enterica serovar Typhi (Salmonella typhi) strain CT18, complete chromosome; segment 2/20 hsp_num: 1 from: 202992 to: 203048
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 1 from: 6553 to: 6609
gi-nr: gi|16418900 gi_def: Salmonella typhimurium LT2, section 22 of 220 of the complete genome hsp_num: 1 from: 11161 to: 11217
gi-nr: gi|151363173 gi_def: Shewanella baltica OS185, complete genome hsp_num: 1 from: 3364016 to: 3364072
gi-nr: gi|125995462 gi_def: Shewanella baltica OS155, complete genome hsp_num: 1 from: 3276020 to: 3276076
gi-nr: gi|117610791 gi_def: Shewanella sp. ANA-3, complete genome hsp_num: 1 from: 1665263 to: 1665319
gi-nr: gi|24371479 gi_def: Shewanella oneidensis MR-1, complete genome hsp_num: 1 from: 3241819 to: 3241875
gi-nr: gi|114332481 gi_def: Shewanella frigidimarina NCIMB 400, complete genome hsp_num: 1 from: 3246510 to: 3246566
gi-nr: gi|113886955 gi_def: Shewanella sp. MR-7, complete genome hsp_num: 1 from: 1681919 to: 1681975
gi-nr: gi|120556926 gi_def: Shewanella sp. W3-18-1, complete genome hsp_num: 1 from: 1730964 to: 1731020
gi-nr: gi|113883030 gi_def: Shewanella sp. MR-4, complete genome hsp_num: 1 from: 1610491 to: 1610547
gi-nr: gi|145562801 gi_def: Shewanella putrefaciens CN-32, complete genome hsp_num: 1 from: 2883438 to: 2883494
gi-nr: gi|126636230 gi_def: Shewanella loihica PV-4, complete genome hsp_num: 1 from: 2730678 to: 2730734
gi-nr: gi|91713371 gi_def: Shewanella denitrificans OS217, complete genome hsp_num: 1 from: 1634769 to: 1634825
gi-nr: gi|126096280 gi_def: Actinobacillus pleuropneumoniae L20 serotype 5b complete genome hsp_num: 1 from: 831699 to: 831755
gi-nr: gi|156617157 gi_def: Haemophilus influenzae 86-028NP, complete genome hsp_num: 1 from: 334827 to: 334883
gi-nr: gi|148717999 gi_def: Haemophilus influenzae PittGG, complete genome hsp_num: 1 from: 728241 to: 728297
gi-nr: gi|6626252 gi_def: Haemophilus influenzae Rd KW20, complete genome hsp_num: 1 from: 271714 to: 271770
gi-nr: gi|148715293 gi_def: Haemophilus influenzae PittEE, complete genome hsp_num: 1 from: 352547 to: 352603
gi-nr: gi|33149228 gi_def: Haemophilus ducreyi strain 35000HP complete genome hsp_num: 1 from: 1117274 to: 1117330
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 1 from: 627259 to: 627327
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128886 to: 128942
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 1 from: 976510 to: 976566
gi-nr: gi|119765642 gi_def: Shewanella amazonensis SB2B, complete genome hsp_num: 1 from: 2651444 to: 2651500
gi-nr: gi|157320013 gi_def: Serratia proteamaculans 568, complete genome hsp_num: 1 from: 1168882 to: 1168938
gi-nr: gi|51587641 gi_def: Yersinia pseudotuberculosis IP32953 genome, complete sequence hsp_num: 1 from: 1122710 to: 1122766
gi-nr: gi|152958308 gi_def: Yersinia pseudotuberculosis IP 31758, complete genome hsp_num: 1 from: 3513598 to: 3513654
gi-nr: gi|108777911 gi_def: Yersinia pestis Antiqua, complete genome hsp_num: 1 from: 2985106 to: 2985162
gi-nr: gi|30407161 gi_def: Yersinia pestis CO92 complete genome hsp_num: 1 from: 3552716 to: 3552772
gi-nr: gi|22002119 gi_def: Yersinia pestis KIM, complete genome hsp_num: 1 from: 1122998 to: 1123054
gi-nr: gi|45438631 gi_def: Yersinia pestis biovar Microtus str. 91001, complete genome hsp_num: 1 from: 802753 to: 802809
gi-nr: gi|108773814 gi_def: Yersinia pestis Nepal516, complete genome hsp_num: 1 from: 1050138 to: 1050194
gi-nr: gi|145209020 gi_def: Yersinia pestis Pestoides F, complete genome hsp_num: 1 from: 3199671 to: 3199727
gi-nr: gi|156530483 gi_def: Enterobacter sakazakii ATCC BAA-894, complete genome hsp_num: 1 from: 2848259 to: 2848315
gi-nr: gi|150839411 gi_def: Actinobacillus succinogenes 130Z, complete genome hsp_num: 1 from: 1156650 to: 1156706
gi-nr: gi|12720451 gi_def: Pasteurella multocida subsp. multocida str. Pm70 section 24 of 204 of the complete genome hsp_num: 1 from: 3676 to: 3732
gi-nr: gi|52306107 gi_def: Mannheimia succiniciproducens MBEL55E, complete genome hsp_num: 1 from: 1554470 to: 1554526
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 1 from: 2696828 to: 2696884
gi-nr: gi|112822192 gi_def: Haemophilus somnus 129PT, complete genome hsp_num: 1 from: 1505807 to: 1505863
gi-nr: gi|76873893 gi_def: Pseudoalteromonas haloplanktis str. TAC125 chromosome I, complete sequence hsp_num: 1 from: 335682 to: 335738
gi-nr: gi|110645972 gi_def: Alcanivorax borkumensis SK2, complete genome hsp_num: 1 from: 551257 to: 551313
gi-nr: gi|71795899 gi_def: Candidatus Blochmannia pennsylvanicus str. BPEN, complete genome hsp_num: 1 from: 267508 to: 267564
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 1 from: 140120 to: 140176
gi-nr: gi|54113018 gi_def: Synthetic construct Francisella tularensis clone FLH156566.01X NT02FT1390 gene, complete cds hsp_num: 1 from: 970 to: 1026
gi-nr: gi|114225560 gi_def: Alkalilimnicola ehrlichei MLHE-1, complete genome hsp_num: 1 from: 1417992 to: 1418048
gi-nr: gi|62260342 gi_def: Synthetic construct isolate FTT1120 unknown protein gene, complete cds hsp_num: 1 from: 1048 to: 1104
gi-nr: gi|47118299 gi_def: Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete sequence hsp_num: 1 from: 139630 to: 139686
gi-nr: gi|146325996 gi_def: Candidatus Vesicomyosocius okutanii HA DNA, complete genome hsp_num: 1 from: 760776 to: 760832
gi-nr: gi|118422521 gi_def: Francisella tularensis subsp. novicida U112, complete genome hsp_num: 1 from: 1161467 to: 1161523
gi-nr: gi|134048946 gi_def: Francisella tularensis subsp. tularensis WY96-3418, complete genome hsp_num: 1 from: 1091104 to: 1091160
gi-nr: gi|89143280 gi_def: Francisella tularensis subsp. holarctica LVS complete genome hsp_num: 1 from: 825524 to: 825580
gi-nr: gi|115128880 gi_def: Francisella tularensis subsp. holarctica OSU18, complete genome hsp_num: 1 from: 829180 to: 829236
gi-nr: gi|56603679 gi_def: Francisella tularensis subsp. tularensis SCHU S4 complete genome hsp_num: 1 from: 1130164 to: 1130220
gi-nr: gi|110319990 gi_def: Francisella tularensis subsp. tularensis strain FSC 198 complete genome hsp_num: 1 from: 1130115 to: 1130171
gi-nr: gi|156251972 gi_def: Francisella tularensis subsp. holarctica FTA, complete genome hsp_num: 1 from: 827279 to: 827335
gi-nr: gi|110744159 gi_def: Thiomicrospira crunogena XCL-2, complete genome hsp_num: 1 from: 1448002 to: 1448058
gi-nr: gi|33518905 gi_def: Blochmannia floridanus complete genome hsp_num: 1 from: 245097 to: 245147
gi-nr: gi|89949249 gi_def: Saccharophagus degradans 2-40, complete genome hsp_num: 1 from: 1822928 to: 1822978
gi-nr: gi|91708343 gi_def: Methylobacillus flagellatus KT, complete genome hsp_num: 1 from: 535205 to: 535261
gi-nr: gi|30407130 gi_def: Nitrosomonas europaea ATCC 19718, complete genome hsp_num: 1 from: 1239174 to: 1239230
gi-nr: gi|114307050 gi_def: Nitrosomonas eutropha C91, complete genome hsp_num: 1 from: 1513062 to: 1513118
gi-nr: gi|76881875 gi_def: Nitrosococcus oceani ATCC 19707, complete genome hsp_num: 1 from: 2696375 to: 2696431
gi-nr: gi|91795226 gi_def: Chromohalobacter salexigens DSM 3043, complete genome hsp_num: 1 from: 3163238 to: 3163294
gi-nr: gi|133737197 gi_def: Herminiimonas arsenicoxydans chromosome, complete sequence hsp_num: 2 from: 300202 to: 300249
gi-nr: gi|151279845 gi_def: Janthinobacterium sp. Marseille, complete genome hsp_num: 1 from: 393826 to: 393873


Query-DNA-Entry-Section

Query-DNA-Def dare_229|beg|1454|length|110|forward|gi
Query_DNA-Sequence
tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgtaaccgggtgaacg

Coding-DNA-Entry-Section

Coding-DNA
tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgt
Protein-Sequence
SDGRFVLVAKFTEARLQEIRNYAVGAEHHYFA*P
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130048 to: 130119
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755161 to: 755229
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439539 to: 439607
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057896 to: 1057967
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617556 to: 617627

Coding-DNA
tccgatggccgttttgtgctcgtggctaagtttaccgaagctcgcttacaggaaattcgcaactacgccgttggagcagaacatcactattttgcgt
Protein-Sequence
SDGRFVLVAKFTEARLQEIRNYAVGAEHHYFA*P
Hit-Information Section
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 130048 to: 130119
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755161 to: 755229
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439539 to: 439607
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057896 to: 1057967
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617556 to: 617627


Query-DNA-Entry-Section

Query-DNA-Def dare_233|beg|1040|length|139|forward|gi
Query_DNA-Sequence
gctcttgaaaatggctcaatccttgttcgtttcTaatgatacgggatacgcaaatcaTgcgcccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatattggc

Coding-DNA-Entry-Section

Coding-DNA
ccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatat
Protein-Sequence
ARDIISEALGKDKIVALNLAPSTPY
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057536 to: 1057613
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754798 to: 754875
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439893 to: 439970
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617196 to: 617273
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205341 to: 2205418

Coding-DNA
ccgagatatcatcagtgaagcgttaggtaaggataaaatcgtcgcgttaaacctcgctccttcaacgccatat
Protein-Sequence
ARDIISEALGKDKIVALNLAPSTPY
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057536 to: 1057613
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754798 to: 754875
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439893 to: 439970
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617196 to: 617273
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205341 to: 2205418


Query-DNA-Entry-Section

Query-DNA-Def dare_234|beg|2190|length|127|forward|gi
Query_DNA-Sequence
atatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgttgatcat

Coding-DNA-Entry-Section

Coding-DNA
tatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgt
Protein-Sequence
IDMGIQACIWGMVAVMLFTVLYYRKFGMIANIALMANLVL
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287902 to: 288024
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438872
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755896 to: 756018
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058634 to: 1058756
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618294 to: 618416
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204320

Coding-DNA
tatcgatatgggtattcaggcctgtatttggggtatggtggcggtaatgctgtttacggttctttactaccgtaagtttggcatgattgctaacatcgcactaatggcgaacctcgtgt
Protein-Sequence
IDMGIQACIWGMVAVMLFTVLYYRKFGMIANIALMANLVL
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 3 from: 287902 to: 288024
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 438750 to: 438872
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755896 to: 756018
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058634 to: 1058756
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 618294 to: 618416
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204198 to: 2204320


Query-DNA-Entry-Section

Query-DNA-Def dare_237|beg|708|length|102|forward|gi
Query_DNA-Sequence
ctgaagataacgcttTacatcacaaTtcgagttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctaccaaaaggtcgctgaaa

Coding-DNA-Entry-Section

Coding-DNA
gttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctacca
Protein-Sequence
ELNTNNEGCIKKDFVTAVLP
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057238
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440268 to: 440333
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754500
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205748 to: 2205813
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129327 to: 129389

Coding-DNA
gttgaacaccaacaacgaaggttgtatcaagaaggacttcgtgactgcagtgctacca
Protein-Sequence
ELNTNNEGCIKKDFVTAVLP
Hit-Information Section
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1057173 to: 1057238
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440268 to: 440333
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 754435 to: 754500
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2205748 to: 2205813
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 129327 to: 129389


Query-DNA-Entry-Section

Query-DNA-Def dare_239|beg|275|length|141|forward|gi
Query_DNA-Sequence
aagcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcgtggtaagcc

Coding-DNA-Entry-Section

Coding-DNA
agcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcg
Protein-Sequence
SIRKAIDEDRFDQFVAEFYARRNREVPPLQKDQSLISCTGLDLR
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440706 to: 440798
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753970 to: 754062
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206169 to: 2206258
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129038

Coding-DNA
agcattcgtaaagcgattgatgaagaccgttttgaccaatttgtagccgagttctacgcgcgtcgtaaccgcgaagtgccaccactacaaaaagaTcaaagcctgatttcgtgcactgggttggatttgcg
Protein-Sequence
SIRKAIDEDRFDQFVAEFYARRNREVPPLQKDQSLISCTGLDLR
Hit-Information Section
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 440706 to: 440798
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 753970 to: 754062
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2206169 to: 2206258
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 1 from: 128949 to: 129038


Query-DNA-Entry-Section

Query-DNA-Def dare_241|beg|1722|length|142|forward|gi
Query_DNA-Sequence
cggcagTcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcaagcattaccgTatgcaagctcaagcgccgacgaatatggtcgccca

Coding-DNA-Entry-Section

Coding-DNA
ggcagTcaggacgtgcgcctgctggcagcgaaatcaagttcgatcgtaatggtcgtcctgtggtgctgaaaaagcgcgtgattctgggtggttcaagcattaccgTatgcaagctcaagcgccgacgaatatggtcgccca
Protein-Sequence
RQSGRAPAGSEIKFDRNGRPVVLKKRVILGGSSITVCKLKRRRIWSP
Hit-Information Section
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287437 to: 287535
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 1 from: 2204687 to: 2204785
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058169 to: 1058267
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 1 from: 755431 to: 755529
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 1 from: 439239 to: 439337
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 1 from: 617829 to: 617927


Query-DNA-Entry-Section

Query-DNA-Def dare_243|beg|390|length|129|forward|gi
Query_DNA-Sequence
ctgggttggatttgcgtggtaagccgcttgaattcaccctgtgcatcccaatagaatcaaacattaaacaacaataacttagaggcgtttctcaatgagtttaatttctgtagcaccatgccgcaggcg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_244|beg|1444|length|112|forward|gi
Query_DNA-Sequence
gacttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgcaactacgccgttgagcagaacatcactattttgcgtaac

Coding-DNA-Entry-Section

Coding-DNA
acttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgc
Protein-Sequence
LRISCKRASGKNLATSTKRPSDSEV
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 651 to: 713
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287199 to: 287261
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796489 to: 796551
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439513 to: 439581
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755187 to: 755255
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130083 to: 130142
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057925 to: 1057993
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617585 to: 617653
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204961 to: 2205023

Coding-DNA
acttcagaatccgatggccgttttgtgctcgtggctaagTtttTaccTgaagctcgcttacaggaaattcgc
Protein-Sequence
LRISCKRASGKNLATSTKRPSDSEV
Hit-Information Section
gi-nr: gi|109703866 gi_def: Synthetic construct Vibrio cholerae clone FLH175451.01F secD-1 gene, complete sequence hsp_num: 5 from: 651 to: 713
gi-nr: gi|146314918 gi_def: Vibrio cholerae O395 chromosome 2, complete genome hsp_num: 5 from: 287199 to: 287261
gi-nr: gi|12057212 gi_def: Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence hsp_num: 5 from: 796489 to: 796551
gi-nr: gi|91983532 gi_def: Vibrio vulnificus CMCP6 chromosome I complete sequence hsp_num: 2 from: 439513 to: 439581
gi-nr: gi|37509034 gi_def: Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence hsp_num: 2 from: 755187 to: 755255
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130083 to: 130142
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 2 from: 1057925 to: 1057993
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 2 from: 617585 to: 617653
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 2 from: 2204961 to: 2205023


Query-DNA-Entry-Section

Query-DNA-Def dare_246|beg|1778|length|131|forward|gi
Query_DNA-Sequence
cctgtggtgctgaaaagcgcgtgattctgggtggttcaaTgcattacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaacaagagtcagcg

Coding-DNA-Entry-Section

Coding-DNA
tacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaac
Protein-Sequence
CCRLRYRAKCSTCGRPYSSALELAS*C
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204646 to: 2204720
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 1235300 to: 1235332
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058234 to: 1058308
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130386 to: 130460

Coding-DNA
tacgatgcaagctcaagcgccgacgaatatggtcgcccacaggtTgaacatttcgctcgatagcgaaggcggcaac
Protein-Sequence
CCRLRYRAKCSTCGRPYSSALELAS*C
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 3 from: 2204646 to: 2204720
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 4 from: 1235300 to: 1235332
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 1 from: 1058234 to: 1058308
gi-nr: gi|46912264 gi_def: Photobacterium profundum SS9; segment 3/12 hsp_num: 2 from: 130386 to: 130460


Query-DNA-Entry-Section

Query-DNA-Def dare_249|beg|955|length|130|forward|gi
Query_DNA-Sequence
ggcgcgtggcgcctctgttgatatgtcaacgctggatgctgtcaccgatgcgctcaataaaTgcgcaactctcccaaaaatccattgctcttgTaaaatggctcaatccttgttcgtttcaatgatacgg

Coding-DNA-Entry-Section


Query-DNA-Entry-Section

Query-DNA-Def dare_250|beg|42|length|118|forward|gi
Query_DNA-Sequence
gtgatgccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgcagTcacataaaaccTgatacaacaccactggatTcctcattgcgac

Coding-DNA-Entry-Section

Coding-DNA
gccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgca
Protein-Sequence
CQRVTHVTVTYLLTGGVIKIRNA
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 8 from: 2206421 to: 2206453
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 8 from: 1056453 to: 1056485
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 6 from: 616128 to: 616160
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1049 to: 1081
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1050 to: 1082
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490602 to: 490634
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490600 to: 490632
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501162 to: 501194
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 442943 to: 442975
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441354 to: 441386
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1273754 to: 1273786
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 459846 to: 459878
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494461 to: 494493
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412065 to: 412097
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426195 to: 426227
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490763 to: 490795
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426195 to: 426227
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356469 to: 356501
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355604 to: 355636
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390568 to: 390600
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 315942 to: 315974
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 976378 to: 976410
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316906 to: 316938
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108714 to: 1108746
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6421 to: 6453
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 2 from: 139988 to: 140020
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 627139 to: 627171
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2696984 to: 2697013

Coding-DNA
gccaacgcgtaacgcacgtaacggtcacctatttgTtgacgggtggtgtgatcaagatccgtaatgca
Protein-Sequence
CQRVTHVTVTYLLTGGVIKIRNA
Hit-Information Section
gi-nr: gi|59478708 gi_def: Vibrio fischeri ES114 chromosome I, complete sequence hsp_num: 8 from: 2206421 to: 2206453
gi-nr: gi|156523975 gi_def: Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence hsp_num: 8 from: 1056453 to: 1056485
gi-nr: gi|47118310 gi_def: Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1, complete sequence hsp_num: 6 from: 616128 to: 616160
gi-nr: gi|530258 gi_def: Shigella flexneri genes for VacC and ORF hsp_num: 2 from: 1049 to: 1081
gi-nr: gi|147965 gi_def: E.coli tRNA-guanine-transglycosylase (tgt) gene, complete cds hsp_num: 2 from: 1050 to: 1082
gi-nr: gi|56384585 gi_def: Escherichia coli O157:H7 EDL933, complete genome hsp_num: 2 from: 490602 to: 490634
gi-nr: gi|47118301 gi_def: Escherichia coli O157:H7 str. Sakai DNA, complete genome hsp_num: 2 from: 490600 to: 490632
gi-nr: gi|26111730 gi_def: Escherichia coli CFT073, complete genome hsp_num: 2 from: 501162 to: 501194
gi-nr: gi|115511419 gi_def: Escherichia coli APEC O1, complete genome hsp_num: 2 from: 442943 to: 442975
gi-nr: gi|91070629 gi_def: Escherichia coli UTI89, complete genome hsp_num: 2 from: 441354 to: 441386
gi-nr: gi|49609491 gi_def: Erwinia carotovora subsp. atroseptica SCRI1043, complete genome hsp_num: 2 from: 1273754 to: 1273786
gi-nr: gi|157076741 gi_def: Escherichia coli E24377A, complete genome hsp_num: 2 from: 459846 to: 459878
gi-nr: gi|110341805 gi_def: Escherichia coli 536, complete genome hsp_num: 2 from: 494461 to: 494493
gi-nr: gi|73854091 gi_def: Shigella sonnei Ss046, complete genome hsp_num: 2 from: 412065 to: 412097
gi-nr: gi|85674274 gi_def: Escherichia coli W3110 DNA, complete genome hsp_num: 2 from: 426195 to: 426227
gi-nr: gi|157065147 gi_def: Escherichia coli HS, complete genome hsp_num: 2 from: 490763 to: 490795
gi-nr: gi|48994873 gi_def: Escherichia coli K12 MG1655, complete genome hsp_num: 2 from: 426195 to: 426227
gi-nr: gi|24080789 gi_def: Shigella flexneri 2a str. 301, complete genome hsp_num: 2 from: 356469 to: 356501
gi-nr: gi|30043918 gi_def: Shigella flexneri 2a str. 2457T, complete genome hsp_num: 2 from: 355604 to: 355636
gi-nr: gi|110613622 gi_def: Shigella flexneri 5 str. 8401, complete genome hsp_num: 2 from: 390568 to: 390600
gi-nr: gi|81244029 gi_def: Shigella boydii Sb227, complete genome hsp_num: 2 from: 315942 to: 315974
gi-nr: gi|145316543 gi_def: Enterobacter sp. 638, complete genome hsp_num: 2 from: 976378 to: 976410
gi-nr: gi|81239530 gi_def: Shigella dysenteriae Sd197, complete genome hsp_num: 2 from: 316906 to: 316938
gi-nr: gi|84778498 gi_def: Sodalis glossinidius str. 'morsitans' DNA, complete genome hsp_num: 2 from: 1108714 to: 1108746
gi-nr: gi|1773084 gi_def: Escherichia coli minutes 9 to 11 genomic sequence hsp_num: 2 from: 6421 to: 6453
gi-nr: gi|21672292 gi_def: Buchnera aphidicola str. Sg (Schizaphis graminum), complete genome hsp_num: 2 from: 139988 to: 140020
gi-nr: gi|94219610 gi_def: Baumannia cicadellinicola str. Hc (Homalodisca coagulata), complete genome hsp_num: 2 from: 627139 to: 627171
gi-nr: gi|119862398 gi_def: Psychromonas ingrahamii 37, complete genome hsp_num: 2 from: 2696984 to: 2697013


Statistic-Section